eF-site ID 5ng7-A PDB Code 5ng7 Chain A click to enlarge Title Novel epoxide hydrolases belonging to the alpha/beta hydrolases superfamily in metagenomes from hot environments Classification HYDROLASE Compound epoxide hydrolase Source (5NG7) Sequence A:  NEMLKHEYVKVNGIKMHYVTQGKGKLLLLLHGFPDFWYVW RFQIPALAKHFRVVAPDLRGYNETDKPEGVENYRLDLLAK DILGLIKALGEEHAVVVGHDWGGIISWTLTAFNPQAVEKL VILNAPHPKAYMTRTKNSLRQLQKSWYVFFFQVANIPEKI LSRNEFAFLKNMLIQSFVRRDLLTEEDLRIYVDAWSKSGA LTSALNYYRANLNPDIIFSEKTVVFPKIKVPTLVIWGEKD VAISKDLIVNMEDFIEAPYSIKYFPECGHWVQLEEPELVR KHIEEFILKSDI Description Functional site 1) chain A residue 265 type sequence F description binding site for residue CL A 301 source : AC1 2) chain A residue 266 type sequence P description binding site for residue CL A 301 source : AC1 3) chain A residue 267 type sequence E description binding site for residue CL A 301 source : AC1 4) chain A residue 168 type sequence A description binding site for residue EDO A 302 source : AC2 5) chain A residue 138 type sequence N description binding site for residue EDO A 303 source : AC3 6) chain A residue 140 type sequence L description binding site for residue EDO A 303 source : AC3 7) chain A residue 141 type sequence R description binding site for residue EDO A 303 source : AC3 8) chain A residue 137 type sequence K description binding site for residue PEG B 305 source : AC8 9) chain A residue 138 type sequence N description binding site for residue PEG B 305 source : AC8

Display surface Download Links