eF-site ID 5n9w-A
PDB Code 5n9w
Chain A

click to enlarge
Title Structure of adenylation domain THR1 involved in the biosynthesis of 4-chlorothreonine in Streptomyces SP.OH-5093, apo structure
Classification TRANSFERASE
Compound Adenylation domain
Source Streptomyces sp (H6SG27_STRSQ)
Sequence A:  ATLVDLFSRAAMEMPDRTALHIDDEKISYGLLHSWAEGLA
DLLHDAGVRKGDRVALRMPPGANAIAAMLGILRAGAAYVP
LDIRNPPARNAFIVTDSQVVALVGDPGYTGPLVTEENVAA
LRDRGPERPGPQDVAYIIYTSGRPKGVPVRHGNVTALFEA
CSRLFSFSADDRWLLFHSMAFDFSVWEIWGALSTGAELVV
LTPVETARVVRDRGITVLNQTPTAFGALTTAVLGEGIDLP
ELRYVVFGGEKLTPAVVRPWAKRFGLDRPHLINMYGITET
TVHATFHRLTEDDLAAEDSVIGRPLPGFTHRIVTEDGRDA
ATGEPGELWLAGPQVSEGYLNRPELTAERFTTPPRYYHSG
DLVSRRAGGDLVYQGRADLQVKLRGHRIELSDVEAAVRTH
PAVVDAVVWVHEFAPGDSRLVCAYTAQPDARALRAHVKTV
LPSYMQPSQYLALPELPRTINGKADRASVARAFDERR
Description (1)  Adenylation domain


Functional site

1) chain A
residue 279
type
ligand
sequence R
description binding site for residue ACT A 601
source : AC1

2) chain A
residue 406
type BINDING
ligand
sequence D
description ATP. {ECO:0000213|PDB:5APB}.
source Swiss-Prot : SWS_FT_FI1

3) chain A
residue 421
type BINDING
ligand
sequence R
description ATP. {ECO:0000213|PDB:5APB}.
source Swiss-Prot : SWS_FT_FI1

4) chain A
residue 406
type BINDING
ligand
sequence D
description AMP. {ECO:0000213|PDB:5APB}.
source Swiss-Prot : SWS_FT_FI2

5) chain A
residue 167-168
type NP_BIND
ligand
sequence TS
description ATP. {ECO:0000213|PDB:5APB}.
source Swiss-Prot : SWS_FT_FI3

6) chain A
residue 285-286
type NP_BIND
ligand
sequence GE
description ATP. {ECO:0000213|PDB:5APB}.
source Swiss-Prot : SWS_FT_FI3

7) chain A
residue 309-314
type NP_BIND
ligand
sequence NMYGIT
description ATP. {ECO:0000213|PDB:5APB}.
source Swiss-Prot : SWS_FT_FI3

8) chain A
residue 285-286
type NP_BIND
ligand
sequence GE
description AMP. {ECO:0000213|PDB:5APB}.
source Swiss-Prot : SWS_FT_FI4

9) chain A
residue 309-314
type NP_BIND
ligand
sequence NMYGIT
description AMP. {ECO:0000213|PDB:5APB}.
source Swiss-Prot : SWS_FT_FI4

10) chain A
residue 418-421
type NP_BIND
ligand
sequence YQGR
description AMP. {ECO:0000213|PDB:5APB}.
source Swiss-Prot : SWS_FT_FI4

11) chain A
residue 513-515
type NP_BIND
ligand
sequence NGK
description AMP. {ECO:0000213|PDB:5APB}.
source Swiss-Prot : SWS_FT_FI4

12) chain A
residue 279-280
type binding
ligand ACT: ACETATE ION
sequence RY
description ACETATE ION binding site
source pdb_hetatom : ACT_5n9w_A_601

13) chain A
residue 303-304
type binding
ligand ACT: ACETATE ION
sequence DR
description ACETATE ION binding site
source pdb_hetatom : ACT_5n9w_A_601

14) chain A
residue 306
type binding
ligand ACT: ACETATE ION
sequence H
description ACETATE ION binding site
source pdb_hetatom : ACT_5n9w_A_601


Display surface

Download
Links