eF-site ID 5mpc-1
PDB Code 5mpc
Chain 1

click to enlarge
Title 26S proteasome in presence of BeFx (s4)
Classification HYDROLASE
Compound Proteasome subunit alpha type-1
Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae (strain ATCC 204508 / S288c);
Sequence 1:  TSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDK
IWCCRSGSAADTQAIADIVQYHLELYTSQYGTPSTETAAS
VFKELCYENKDNLTAGIIVAGYDDKNKGEVYTIPLGGSVH
KLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLS
QAIKWDGSSGGVIRMVVLTAAGVERLIFYPDEYEQL
Description (1)  Proteasome subunit alpha type-1 (E.C.3.4.25.1), Proteasome subunit alpha type-2 (E.C.3.4.25.1), Proteasome subunit alpha type-3 (E.C.3.4.25.1), Proteasome subunit alpha type-4 (E.C.3.4.25.1), Proteasome subunit alpha type-5 (E.C.3.4.25.1), Proteasome subunit alpha type-6 (E.C.3.4.25.1), Probable proteasome subunit alpha type-7 (E.C.3.4.25.1), Proteasome subunit beta type-1 (E.C.3.4.25.1), Proteasome subunit beta type-2 (E.C.3.4.25.1), Proteasome subunit beta type-3 (E.C.3.4.25.1), Proteasome subunit beta type-4 (E.C.3.4.25.1), Proteasome subunit beta type-5 (E.C.3.4.25.1), Proteasome subunit beta type-6 (E.C.3.4.25.1), Proteasome subunit beta type-7 (E.C.3.4.25.1), 26S protease regulatory subunit 7 homolog, 26S protease regulatory subunit 4 homolog, 26S protease regulatory subunit 6B homolog, 26S protease subunit RPT4, 26S protease regulatory subunit 6A, 26S protease regulatory subunit 8 homolog, Ubiquitin carboxyl-terminal hydrolase 6 (E.C.3.4.19.12), 26S proteasome regulatory subunit RPN10, Ubiquitin carboxyl-terminal hydrolase RPN11 (E.C.3.4.19.12), 26S proteasome regulatory subunit RPN12, 26S proteasome regulatory subunit RPN13, 26S proteasome complex subunit SEM1, 26S proteasome regulatory subunit RPN1, 26S proteasome regulatory subunit RPN2, 26S proteasome regulatory subunit RPN3, 26S proteasome regulatory subunit RPN5, 26S proteasome regulatory subunit RPN6, 26S proteasome regulatory subunit RPN7, 26S proteasome regulatory subunit RPN8, 26S proteasome regulatory subunit RPN9

Display surface

Download
Links