eF-site ID 5mpb-L PDB Code 5mpb Chain L click to enlarge Title 26S proteasome in presence of AMP-PNP (s3) Classification HYDROLASE Compound Proteasome subunit alpha type-1 Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae (strain ATCC 204508 / S288c); Sequence L:  EQEAHNKALNQFKRKLLEHRRYDDQLKQRRQNIRDLEKLY DKTENDIKALQSIGQLIGEVMKELSEEKYIVKASSGPRYI VGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVY NMTSFEQGEITFDGIGGLTEQIRELREVIELPLKNPEIFQ RVGIKPPKGVLLYGPPGTGKTLLAKAVAATIGANFIFSPA SGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGG RRFSEGTSADREIQRTLMELLTQMDGFDNLGQTKIIMATN RPDTLDPALLRPGRLDRKVEIPLPNEAGRLEIFKIHTAKV KKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRD HINPDDLMKAVRKVAEVKKLEGTIEYQK Description (1)  Proteasome subunit alpha type-1 (E.C.3.4.25.1), Proteasome subunit alpha type-2 (E.C.3.4.25.1), Proteasome subunit alpha type-3 (E.C.3.4.25.1), Proteasome subunit alpha type-4 (E.C.3.4.25.1), Proteasome subunit alpha type-5 (E.C.3.4.25.1), Proteasome subunit alpha type-6 (E.C.3.4.25.1), Probable proteasome subunit alpha type-7 (E.C.3.4.25.1), Proteasome subunit beta type-1 (E.C.3.4.25.1), Proteasome subunit beta type-2 (E.C.3.4.25.1), Proteasome subunit beta type-3 (E.C.3.4.25.1), Proteasome subunit beta type-4 (E.C.3.4.25.1), Proteasome subunit beta type-5 (E.C.3.4.25.1), Proteasome subunit beta type-6 (E.C.3.4.25.1), Proteasome subunit beta type-7 (E.C.3.4.25.1), 26S protease regulatory subunit 7 homolog, 26S protease regulatory subunit 4 homolog, 26S protease regulatory subunit 6B homolog, 26S protease subunit RPT4, 26S protease regulatory subunit 6A, 26S protease regulatory subunit 8 homolog, 26S proteasome regulatory subunit RPN10, Ubiquitin carboxyl-terminal hydrolase RPN11 (E.C.3.4.19.12), 26S proteasome regulatory subunit RPN12, 26S proteasome regulatory subunit RPN13, 26S proteasome complex subunit SEM1, 26S proteasome regulatory subunit RPN1, 26S proteasome regulatory subunit RPN2, 26S proteasome regulatory subunit RPN3, 26S proteasome regulatory subunit RPN5, 26S proteasome regulatory subunit RPN6, 26S proteasome regulatory subunit RPN7, 26S proteasome regulatory subunit RPN8, 26S proteasome regulatory subunit RPN9 Functional site 1) chain L residue 313 type sequence D description binding site for residue ANP K 501 source : AC5 2) chain L residue 339 type sequence R description binding site for residue ANP K 501 source : AC5 3) chain L residue 341 type sequence G description binding site for residue ANP K 501 source : AC5 4) chain L residue 183 type sequence I description binding site for residue ANP L 501 source : AC7 5) chain L residue 184 type sequence G description binding site for residue ANP L 501 source : AC7 6) chain L residue 224 type sequence P description binding site for residue ANP L 501 source : AC7 7) chain L residue 225 type sequence G description binding site for residue ANP L 501 source : AC7 8) chain L residue 226 type sequence T description binding site for residue ANP L 501 source : AC7 9) chain L residue 227 type sequence G description binding site for residue ANP L 501 source : AC7 10) chain L residue 228 type sequence K description binding site for residue ANP L 501 source : AC7 11) chain L residue 229 type sequence T description binding site for residue ANP L 501 source : AC7 12) chain L residue 388 type sequence G description binding site for residue ANP L 501 source : AC7 13) chain L residue 229 type sequence T description binding site for residue MG L 502 source : AC8 14) chain L residue 321-339 type prosite sequence TKIIMATNRPDTLDPALLR description AAA AAA-protein family signature. IkIImATNrldiLDpALl.R source prosite : PS00674

Display surface Download Links