eF-site ID 5mpb-K PDB Code 5mpb Chain K click to enlarge Title 26S proteasome in presence of AMP-PNP (s3) Classification HYDROLASE Compound Proteasome subunit alpha type-1 Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae (strain ATCC 204508 / S288c); Sequence K:  LSNVNSDIYFKLKKLEKEYELLTLQEDYIKDEQRHLKREL KRAQEEVKRIQSVPLVIGQFLEPIDQNTGIVSSTTGMSYV VRILSTLDRELLKPSMSVALHRHSNALVDILPPDSDSSIS VMGENEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYE QIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNG SEFVHKYLGEGPRMVRDVFRLARENAPSIIFIDEVDSIAT KRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATN RADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASK MSLAPEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNR YVILQSDLEEAYATQVKTDNTVDKFDFYK Description (1)  Proteasome subunit alpha type-1 (E.C.3.4.25.1), Proteasome subunit alpha type-2 (E.C.3.4.25.1), Proteasome subunit alpha type-3 (E.C.3.4.25.1), Proteasome subunit alpha type-4 (E.C.3.4.25.1), Proteasome subunit alpha type-5 (E.C.3.4.25.1), Proteasome subunit alpha type-6 (E.C.3.4.25.1), Probable proteasome subunit alpha type-7 (E.C.3.4.25.1), Proteasome subunit beta type-1 (E.C.3.4.25.1), Proteasome subunit beta type-2 (E.C.3.4.25.1), Proteasome subunit beta type-3 (E.C.3.4.25.1), Proteasome subunit beta type-4 (E.C.3.4.25.1), Proteasome subunit beta type-5 (E.C.3.4.25.1), Proteasome subunit beta type-6 (E.C.3.4.25.1), Proteasome subunit beta type-7 (E.C.3.4.25.1), 26S protease regulatory subunit 7 homolog, 26S protease regulatory subunit 4 homolog, 26S protease regulatory subunit 6B homolog, 26S protease subunit RPT4, 26S protease regulatory subunit 6A, 26S protease regulatory subunit 8 homolog, 26S proteasome regulatory subunit RPN10, Ubiquitin carboxyl-terminal hydrolase RPN11 (E.C.3.4.19.12), 26S proteasome regulatory subunit RPN12, 26S proteasome regulatory subunit RPN13, 26S proteasome complex subunit SEM1, 26S proteasome regulatory subunit RPN1, 26S proteasome regulatory subunit RPN2, 26S proteasome regulatory subunit RPN3, 26S proteasome regulatory subunit RPN5, 26S proteasome regulatory subunit RPN6, 26S proteasome regulatory subunit RPN7, 26S proteasome regulatory subunit RPN8, 26S proteasome regulatory subunit RPN9 Functional site 1) chain K residue 172 type sequence A description binding site for residue ANP K 501 source : AC5 2) chain K residue 173 type sequence D description binding site for residue ANP K 501 source : AC5 3) chain K residue 176 type sequence G description binding site for residue ANP K 501 source : AC5 4) chain K residue 177 type sequence L description binding site for residue ANP K 501 source : AC5 5) chain K residue 215 type sequence P description binding site for residue ANP K 501 source : AC5 6) chain K residue 216 type sequence G description binding site for residue ANP K 501 source : AC5 7) chain K residue 217 type sequence T description binding site for residue ANP K 501 source : AC5 8) chain K residue 218 type sequence G description binding site for residue ANP K 501 source : AC5 9) chain K residue 219 type sequence K description binding site for residue ANP K 501 source : AC5 10) chain K residue 220 type sequence T description binding site for residue ANP K 501 source : AC5 11) chain K residue 221 type sequence M description binding site for residue ANP K 501 source : AC5 12) chain K residue 222 type sequence L description binding site for residue ANP K 501 source : AC5 13) chain K residue 319 type sequence N description binding site for residue ANP K 501 source : AC5 14) chain K residue 381 type sequence A description binding site for residue ANP K 501 source : AC5 15) chain K residue 384 type sequence A description binding site for residue ANP K 501 source : AC5 16) chain K residue 220 type sequence T description binding site for residue MG K 502 source : AC6 17) chain K residue 207 type sequence R description binding site for residue ANP J 501 source : AD2 18) chain K residue 304 type sequence D description binding site for residue ANP J 501 source : AD2 19) chain K residue 307 type sequence D description binding site for residue ANP J 501 source : AD2 20) chain K residue 333 type sequence R description binding site for residue ANP J 501 source : AD2 21) chain K residue 312-330 type prosite sequence VKVIMATNRADTLDPALLR description AAA AAA-protein family signature. IkIImATNrldiLDpALl.R source prosite : PS00674

Display surface Download Links