eF-site ID 5mpb-H PDB Code 5mpb Chain H click to enlarge Title 26S proteasome in presence of AMP-PNP (s3) Classification HYDROLASE Compound Proteasome subunit alpha type-1 Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae (strain ATCC 204508 / S288c); Sequence H:  AAPYAAKLKQTENDLKDIEARIKEKAGVKESDTGLAPSHL WDIMGDRQRLGEEHPLQVARCTKIIKKYVINLKQIAKFVV GLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTM MTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFAT LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGS ELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAVGGA RFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNR PNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMS VERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKV ATEKDFLKAVDKVISGYKKF Description (1)  Proteasome subunit alpha type-1 (E.C.3.4.25.1), Proteasome subunit alpha type-2 (E.C.3.4.25.1), Proteasome subunit alpha type-3 (E.C.3.4.25.1), Proteasome subunit alpha type-4 (E.C.3.4.25.1), Proteasome subunit alpha type-5 (E.C.3.4.25.1), Proteasome subunit alpha type-6 (E.C.3.4.25.1), Probable proteasome subunit alpha type-7 (E.C.3.4.25.1), Proteasome subunit beta type-1 (E.C.3.4.25.1), Proteasome subunit beta type-2 (E.C.3.4.25.1), Proteasome subunit beta type-3 (E.C.3.4.25.1), Proteasome subunit beta type-4 (E.C.3.4.25.1), Proteasome subunit beta type-5 (E.C.3.4.25.1), Proteasome subunit beta type-6 (E.C.3.4.25.1), Proteasome subunit beta type-7 (E.C.3.4.25.1), 26S protease regulatory subunit 7 homolog, 26S protease regulatory subunit 4 homolog, 26S protease regulatory subunit 6B homolog, 26S protease subunit RPT4, 26S protease regulatory subunit 6A, 26S protease regulatory subunit 8 homolog, 26S proteasome regulatory subunit RPN10, Ubiquitin carboxyl-terminal hydrolase RPN11 (E.C.3.4.19.12), 26S proteasome regulatory subunit RPN12, 26S proteasome regulatory subunit RPN13, 26S proteasome complex subunit SEM1, 26S proteasome regulatory subunit RPN1, 26S proteasome regulatory subunit RPN2, 26S proteasome regulatory subunit RPN3, 26S proteasome regulatory subunit RPN5, 26S proteasome regulatory subunit RPN6, 26S proteasome regulatory subunit RPN7, 26S proteasome regulatory subunit RPN8, 26S proteasome regulatory subunit RPN9 Functional site 1) chain H residue 210 type sequence D description binding site for residue ANP H 501 source : AC1 2) chain H residue 211 type sequence V description binding site for residue ANP H 501 source : AC1 3) chain H residue 212 type sequence G description binding site for residue ANP H 501 source : AC1 4) chain H residue 252 type sequence P description binding site for residue ANP H 501 source : AC1 5) chain H residue 253 type sequence G description binding site for residue ANP H 501 source : AC1 6) chain H residue 254 type sequence T description binding site for residue ANP H 501 source : AC1 7) chain H residue 255 type sequence G description binding site for residue ANP H 501 source : AC1 8) chain H residue 256 type sequence K description binding site for residue ANP H 501 source : AC1 9) chain H residue 257 type sequence T description binding site for residue ANP H 501 source : AC1 10) chain H residue 258 type sequence L description binding site for residue ANP H 501 source : AC1 11) chain H residue 310 type sequence E description binding site for residue ANP H 501 source : AC1 12) chain H residue 388 type sequence I description binding site for residue ANP H 501 source : AC1 13) chain H residue 392 type sequence H description binding site for residue ANP H 501 source : AC1 14) chain H residue 416 type sequence G description binding site for residue ANP H 501 source : AC1 15) chain H residue 257 type sequence T description binding site for residue MG H 502 source : AC2 16) chain H residue 309 type sequence D description binding site for residue MG H 502 source : AC2 17) chain H residue 349-367 type prosite sequence IKVMFATNRPNTLDPALLR description AAA AAA-protein family signature. IkIImATNrldiLDpALl.R source prosite : PS00674

Display surface Download Links