eF-site ID 5mnj-E PDB Code 5mnj Chain E click to enlarge Title Structure of MDM2-MDMX-UbcH5B-ubiquitin complex Classification LIGASE Compound Ubiquitin-conjugating enzyme E2 D2 Source (MDM4_HUMAN) Sequence E:  ALKRIHKELNDLARDPPAQCRAGPVGDDMFHWQATIMGPN DSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSN GSIKLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVP EIARIYKTDREKYNRIAREWTQKYAM Description Functional site 1) chain E residue 139 type sequence R description binding site for residue SO4 D 503 source : AC5 2) chain E residue 75 type sequence H description binding site for Di-peptide GLY F 76 and LYS E 85 source : AD2 3) chain E residue 77 type sequence N description binding site for Di-peptide GLY F 76 and LYS E 85 source : AD2 4) chain E residue 78 type sequence I description binding site for Di-peptide GLY F 76 and LYS E 85 source : AD2 5) chain E residue 84 type sequence I description binding site for Di-peptide GLY F 76 and LYS E 85 source : AD2 6) chain E residue 86 type sequence L description binding site for Di-peptide GLY F 76 and LYS E 85 source : AD2 7) chain E residue 117 type sequence D description binding site for Di-peptide GLY F 76 and LYS E 85 source : AD2 8) chain E residue 119 type sequence L description binding site for Di-peptide GLY F 76 and LYS E 85 source : AD2 9) chain E residue 120 type sequence V description binding site for Di-peptide GLY F 76 and LYS E 85 source : AD2 10) chain E residue 134 type sequence Y description binding site for Di-peptide GLY F 76 and LYS E 85 source : AD2

Display surface Download Links