eF-site ID 5m1p-A PDB Code 5m1p Chain A click to enlarge Title Crystal structure of the large terminase nuclease from thermophilic phage G20c with bound Calcium Classification HYDROLASE Compound Terminase large subunit Source (5M1P) Sequence A:  AMNSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGAD FGKNQDYSVFSVLDLDTGAIACLERMNGATWSDQVARLKA LSEDYGHAYVVADTWGVGDAIAEELDAQGINYTPLPVKSS SVKEQLISNLALLMEKGQVAVPNDKTILDELRNFRYYRTA SGNQVMRAYGRGHDDIVMSLALAYSQY Description Functional site 1) chain A residue 294 type sequence D description binding site for residue CA A 501 source : AC1 2) chain A residue 295 type sequence F description binding site for residue CA A 501 source : AC1 3) chain A residue 300 type sequence D description binding site for residue CA A 501 source : AC1 4) chain A residue 301 type sequence Y description binding site for residue CA A 501 source : AC1 5) chain A residue 429 type sequence D description binding site for residue CA A 501 source : AC1 6) chain A residue 294 type BINDING sequence D description BINDING => ECO:0000269|PubMed:28100693 source Swiss-Prot : SWS_FT_FI1 7) chain A residue 347 type BINDING sequence D description BINDING => ECO:0000269|PubMed:28100693 source Swiss-Prot : SWS_FT_FI1 8) chain A residue 429 type BINDING sequence D description BINDING => ECO:0000269|PubMed:28100693 source Swiss-Prot : SWS_FT_FI1 9) chain A residue 300 type SITE sequence D description Modulates nuclease activity => ECO:0000255|HAMAP-Rule:MF_04146 source Swiss-Prot : SWS_FT_FI2 10) chain A residue 428 type SITE sequence D description Possible stabilization of Magnesium 1 => ECO:0000269|PubMed:28100693 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links