eF-site ID 5m1k-A PDB Code 5m1k Chain A click to enlarge Title Crystal structure of the large terminase nuclease from thermophilic phage G20c with bound Magnesium Classification VIRAL PROTEIN Compound Phage terminase large subunit Source (5M1K) Sequence A:  PAMNSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGA DFGKNQDYSVFSVLDLDTGAIACLERMNGATWSDQVARLK ALSEDYGHAYVVADTWGVGDAIAEELDAQGINYTPLPVKS SSVKEQLISNLALLMEKGQVAVPNDKTILDELRNFRYYRT ASGNQVMRAYGRGHDDIVMSLALAYSQYE Description (1)  Large terminase protein Functional site 1) chain A residue 257 type sequence N description binding site for residue SO4 A 501 source : AC1 2) chain A residue 409 type sequence R description binding site for residue SO4 A 501 source : AC1 3) chain A residue 411 type sequence Y description binding site for residue SO4 A 501 source : AC1 4) chain A residue 300 type SITE sequence D description Modulates nuclease activity => ECO:0000255|HAMAP-Rule:MF_04146 source Swiss-Prot : SWS_FT_FI2 5) chain A residue 428 type SITE sequence D description Possible stabilization of Magnesium 1 => ECO:0000269|PubMed:28100693 source Swiss-Prot : SWS_FT_FI3 6) chain A residue 429 type BINDING sequence D description BINDING => ECO:0000269|PubMed:28100693 source Swiss-Prot : SWS_FT_FI1 7) chain A residue 294 type BINDING sequence D description BINDING => ECO:0000269|PubMed:28100693 source Swiss-Prot : SWS_FT_FI1 8) chain A residue 347 type BINDING sequence D description BINDING => ECO:0000269|PubMed:28100693 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links