eF-site ID 5ltv-G PDB Code 5ltv Chain G click to enlarge Title LIGAND BINDING DOMAIN OF PSEUDOMONAS AERUGINOSA PAO1 AMINO ACID CHEMORECPETOR PCTC IN COMPLEX WITH GABA Classification SIGNALING PROTEIN Compound Chemotactic transducer PctC Source (A0A080VJ62_PSEAI) Sequence G:  TENYLGEIGTLTASNIQSWLEGRMHLVEGLASQLALLDQP DEANIARQLEQPVFSRNFASVYLGEAASGTFTMRPYDAMP EGYDPRTRAWYKDALAADRLIVTEPFVILAMSLPVRHAGQ LLGVAAGDMKLETLTAILNSGYAFLVSDAGKILLHPDSGL VLKTLAEAYPKGAPNIVPGVFVSFTPVKGLPGVTWYVALV Description Functional site 1) chain G residue 60 type sequence W description binding site for residue SO4 G 301 source : AE7 2) chain G residue 64 type sequence R description binding site for residue SO4 G 301 source : AE7 3) chain G residue 181 type sequence T description binding site for residue SO4 G 301 source : AE7 4) chain G residue 115 type sequence R description binding site for residue SO4 G 302 source : AE8 5) chain G residue 117 type sequence Y description binding site for residue SO4 G 302 source : AE8 6) chain G residue 252 type sequence K description binding site for residue GOL G 303 source : AE9 7) chain G residue 253 type sequence G description binding site for residue GOL G 303 source : AE9 8) chain G residue 124 type BINDING sequence Y description BINDING => ECO:0000269|PubMed:31964737 source Swiss-Prot : SWS_FT_FI2 9) chain G residue 129 type BINDING sequence R description BINDING => ECO:0000269|PubMed:31964737 source Swiss-Prot : SWS_FT_FI2 10) chain G residue 176 type BINDING sequence D description BINDING => ECO:0000269|PubMed:31964737 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links