eF-site ID 5l65-K PDB Code 5l65 Chain K click to enlarge Title Yeast 20S proteasome with mouse beta5i (1-138) and mouse beta6 (97-111; 118-133) in complex with carfilzomib Classification HYDROLASE/HYDROLASE INHIBITOR Compound Proteasome subunit alpha type-2 Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae (strain ATCC 204508 / S288c); Sequence K:  TTTLAFKFQHGVIVAVDSRATAGSYISSLRMNKVIEINPY LLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAAS KLLSNMMLQYRGMGLSMGSMICGWDKKGPGLYYVDDNGTR LSGQMFSTGSGNTYAYGVLDSNYKWDLSVEDALYLGKRSI LAAAHRDAYSGGSVNLYHVTEDGWIYHGNHDVGELFWKVK EEEGSFNNVIG Description Functional site 1) chain K residue 1 type sequence T description binding site for residue 3BV K 301 source : AC8 2) chain K residue 19 type sequence R description binding site for residue 3BV K 301 source : AC8 3) chain K residue 20 type sequence A description binding site for residue 3BV K 301 source : AC8 4) chain K residue 21 type sequence T description binding site for residue 3BV K 301 source : AC8 5) chain K residue 27 type sequence S description binding site for residue 3BV K 301 source : AC8 6) chain K residue 47 type sequence G description binding site for residue 3BV K 301 source : AC8 7) chain K residue 49 type sequence A description binding site for residue 3BV K 301 source : AC8 8) chain K residue 130 type sequence S description binding site for residue 3BV K 301 source : AC8 9) chain K residue 169 type sequence Y description binding site for residue 3BV K 301 source : AC8 10) chain K residue 164 type sequence A description binding site for residue MG K 302 source : AC9 11) chain K residue 165 type sequence H description binding site for residue MG K 302 source : AC9 12) chain K residue 167 type sequence D description binding site for residue MG K 302 source : AC9 13) chain K residue 168 type sequence A description binding site for residue MG K 302 source : AC9 14) chain K residue 170 type sequence S description binding site for residue MG K 302 source : AC9 15) chain K residue 4-51 type prosite sequence LAFKFQHGVIVAVDSRATAGSYISSLRMNKVIEINPYLLG TMSGCAAD description PROTEASOME_BETA_1 Proteasome beta-type subunits signature. LGIaGedFAVLAGDtrnitdysinsryep.KvfdcgdnivmsanGfaAD source prosite : PS00854

Display surface Download Links