eF-site ID 5l65-W PDB Code 5l65 Chain W click to enlarge Title Yeast 20S proteasome with mouse beta5i (1-138) and mouse beta6 (97-111; 118-133) in complex with carfilzomib Classification HYDROLASE/HYDROLASE INHIBITOR Compound Proteasome subunit alpha type-2 Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae (strain ATCC 204508 / S288c); Sequence W:  SDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFE KIFHYGHVFLGITGLATDVTTLNEMFRYKTNLYKLKEERA IEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPFI AGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPE DLFETISQALLNAADRDALSGWGAVVYIIKKDEVVKRYLK MRQD Description Functional site 1) chain W residue 204 type sequence D description binding site for residue MG K 302 source : AC9 2) chain W residue 124 type sequence D description binding site for Di-peptide 3BV V 301 and THR V 1 source : AD8 3) chain W residue 128 type sequence C description binding site for Di-peptide 3BV V 301 and THR V 1 source : AD8 4) chain W residue 124 type sequence D description binding site for Di-peptide 3BV V 301 and THR V 1 source : AD9 5) chain W residue 128 type sequence C description binding site for Di-peptide 3BV V 301 and THR V 1 source : AD9 6) chain W residue 69 type MOD_RES sequence K description Phosphoserine => ECO:0007744|PubMed:18407956 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links