eF-site ID 5l5x-J PDB Code 5l5x Chain J click to enlarge Title Yeast 20S proteasome with human beta5c (1-138) and human beta6 (97-111; 118-133) in complex with ONX 0914 Classification HYDROLASE/HYDROLASE INHIBITOR Compound Proteasome subunit alpha type-2 Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae (strain ATCC 204508 / S288c); Sequence J:  MDIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSP HTLMSFAGEAGDTVQFAEYIQANIQLYSIREDYELSPQAV SSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQID YLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDL LKLCVQELEKRMPMDFKGVIVKIVDKDGIRQVDDF Description Functional site 1) chain J residue 118 type sequence Q description binding site for residue MG J 201 source : AC8 2) chain J residue 124 type sequence T description binding site for residue MG J 201 source : AC8 3) chain J residue 23 type sequence R description binding site for residue MES K 303 source : AD2 4) chain J residue 5-52 type prosite sequence LGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLM SFAGEAGD description PROTEASOME_BETA_1 Proteasome beta-type subunits signature. LGIrVqdSVILASSkavtrgisvlkdsdd.KtrqlsphtlmsfaGeaGD source prosite : PS00854

Display surface Download Links