eF-site ID 5l5x-I PDB Code 5l5x Chain I click to enlarge Title Yeast 20S proteasome with human beta5c (1-138) and human beta6 (97-111; 118-133) in complex with ONX 0914 Classification HYDROLASE/HYDROLASE INHIBITOR Compound Proteasome subunit alpha type-2 Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae (strain ATCC 204508 / S288c); Sequence I:  SDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFE KIFHYGHVFLGITGLATDVTTLNEMFRYKTNLYKLKEERA IEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPFI AGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPE DLFETISQALLNAADRDALSGWGAVVYIIKKDEVVKRYLK MRQD Description Functional site 1) chain I residue 124 type sequence D description binding site for residue 04C H 301 source : AC4 2) chain I residue 126 type sequence I description binding site for residue 04C H 301 source : AC4 3) chain I residue 174 type sequence A description binding site for residue MG I 301 source : AC6 4) chain I residue 177 type sequence D description binding site for residue MG I 301 source : AC6 5) chain I residue 180 type sequence S description binding site for residue MG I 301 source : AC6 6) chain I residue 204 type sequence D description binding site for residue MG I 301 source : AC6 7) chain I residue 204 type sequence D description binding site for residue MG I 302 source : AC7 8) chain I residue 12-58 type prosite sequence VAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYGHVFLG ITGLATD description PROTEASOME_BETA_1 Proteasome beta-type subunits signature. LAFkFrhGVIVAADsratagayiasqtvk.KvieinpyllgtmaGgaAD source prosite : PS00854

Display surface Download Links