eF-site ID 5l5u-J PDB Code 5l5u Chain J click to enlarge Title Yeast 20S proteasome with human beta5i (1-138; V31M) and human beta6 (97-111; 118-133) in complex with epoxyketone inhibitor 17 Classification HYDROLASE/HYDROLASE INHIBITOR Compound Proteasome subunit alpha type-2 Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae (strain ATCC 204508 / S288c); Sequence J:  MDIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSP HTLMSFAGEAGDTVQFAEYIQANIQLYSIREDYELSPQAV SSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQID YLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDL LKLCVQELEKRMPMDFKGVIVKIVDKDGIRQVDDF Description Functional site 1) chain J residue 118 type sequence Q description binding site for residue MG J 201 source : AC7 2) chain J residue 120 type sequence D description binding site for residue MG J 201 source : AC7 3) chain J residue 124 type sequence T description binding site for residue MG J 201 source : AC7 4) chain J residue 5-52 type prosite sequence LGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLM SFAGEAGD description PROTEASOME_BETA_1 Proteasome beta-type subunits signature. VGVkFnnGVVIAADtrstqgpivadknca.KlhrispkiwcagaGtaAD source prosite : PS00854 5) chain J residue 76 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:18407956 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links