eF-site ID 5l5u-W PDB Code 5l5u Chain W click to enlarge Title Yeast 20S proteasome with human beta5i (1-138; V31M) and human beta6 (97-111; 118-133) in complex with epoxyketone inhibitor 17 Classification HYDROLASE/HYDROLASE INHIBITOR Compound Proteasome subunit alpha type-2 Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae (strain ATCC 204508 / S288c); Sequence W:  SDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFE KIFHYGHVFLGITGLATDVTTLNEMFRYKTNLYKLKEERA IEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPFI AGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPE DLFETISQALLNAADRDALSGWGAVVYIIKKDEVVKRYLK MRQD Description Functional site 1) chain W residue 204 type sequence D description binding site for residue MG K 302 source : AC9 2) chain W residue 124 type sequence D description binding site for Di-peptide 04C V 301 and THR V 1 source : AD7 3) chain W residue 124 type sequence D description binding site for Di-peptide 04C V 301 and THR V 1 source : AD8 4) chain W residue 69 type MOD_RES sequence K description Phosphoserine => ECO:0007744|PubMed:18407956 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links