eF-site ID 5l5h-V PDB Code 5l5h Chain V click to enlarge Title Yeast 20S proteasome with human beta5i (1-138) and human beta6 (97-111; 118-133) in complex with PR-924 Classification HYDROLASE/HYDROLASE INHIBITOR Compound Proteasome subunit alpha type-2 Source null (PSB1_YEAST) Sequence V:  TTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPK IWCAGAGTAADTEAVTQLIGSNIELHSLYTSREPRVVSAL QMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTD VGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQ AGIWNDLGSGSNVDVCVMEIGKDAEYLRNYLTPNVREEKQ KSYKFPRGTTAVLKESIVNICDIQEE Description Functional site 1) chain V residue 19 type sequence R description binding site for residue MG L 301 source : AC8 2) chain V residue 163 type sequence I description binding site for residue MG L 301 source : AC8 3) chain V residue 166 type sequence D description binding site for residue MG L 301 source : AC8 4) chain V residue 169 type sequence S description binding site for residue MG L 301 source : AC8 5) chain V residue 69 type sequence Y description binding site for residue CL U 301 source : AD2 6) chain V residue 1 type catalytic sequence T description 177 source MCSA : MCSA2 7) chain V residue 17 type catalytic sequence D description 177 source MCSA : MCSA2 8) chain V residue 19 type catalytic sequence R description 177 source MCSA : MCSA2 9) chain V residue 33 type catalytic sequence K description 177 source MCSA : MCSA2 10) chain V residue 47 type catalytic sequence G description 177 source MCSA : MCSA2 11) chain V residue 129 type catalytic sequence S description 177 source MCSA : MCSA2 12) chain V residue 166 type catalytic sequence D description 177 source MCSA : MCSA2 13) chain V residue 169 type catalytic sequence S description 177 source MCSA : MCSA2

Display surface Download Links