eF-site ID 5l5e-I PDB Code 5l5e Chain I click to enlarge Title Yeast 20S proteasome with human beta5i (1-138) and human beta6 (97-111; 118-133) in complex with carfilzomib Classification HYDROLASE/HYDROLASE INHIBITOR Compound Proteasome subunit alpha type-2 Source Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (PSB1_YEAST) Sequence I:  SDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFE KIFHYGHVFLGITGLATDVTTLNEMFRYKTNLYKLKEERA IEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPFI AGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPE DLFETISQALLNAADRDALSGWGAVVYIIKKDEVVKRYLK MRQD Description Functional site 1) chain I residue 4 type sequence S description binding site for residue 3BV H 301 source : AC3 2) chain I residue 124 type sequence D description binding site for residue 3BV H 301 source : AC3 3) chain I residue 128 type sequence C description binding site for residue 3BV H 301 source : AC3 4) chain I residue 174 type sequence A description binding site for residue MG I 301 source : AC5 5) chain I residue 177 type sequence D description binding site for residue MG I 301 source : AC5 6) chain I residue 180 type sequence S description binding site for residue MG I 301 source : AC5 7) chain I residue 204 type sequence D description binding site for residue MG I 301 source : AC5 8) chain I residue 204 type sequence D description binding site for residue MG I 302 source : AC6 9) chain I residue 12-58 type prosite sequence VAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYGHVFLG ITGLATD description PROTEASOME_BETA_1 Proteasome beta-type subunits signature. LGIaGedFAVLAGDtrnitdysinsryep.KvfdcgdnivmsanGfaAD source prosite : PS00854

Display surface Download Links