eF-site ID 5kal-A PDB Code 5kal Chain A click to enlarge Title Terminal uridylyl transferase 4 from Trypanosoma brucei with bound UTP and UpU Classification Transferase/RNA Compound RNA uridylyltransferase 4 Source Trypanosoma brucei (5KAL) Sequence A:  PPSPAVVGRSLVNSFKQFVSHVDATYRLVLDCVAAVDPLM RLYTFGSTVVYGVHEKGSDVDFVVLNKTDVEDGKGGDAAT QVAKGLQADILAKLARVIRQKHLSWNVEEVRRTRVPVVRV KGGGAVDFDITAYRRNGVRNSALLRAYFEQNPPCRWLSMS IKRWSKQTGLNASVIGGSITSYGFNLMVVYYLLQRNHLQF VPPSTIDVSRVEPLPPHLPLEEPADEGLELGTQVLDFLHF FLHEFDSDKQVISLNRPGITTKEELDWTKSAEDFARMNGE KVHYQWCIEDPYELNLNVGRNVTPLKRDFLRRHLEKARDT ALLTI Description Functional site 1) chain A residue 52 type sequence F description binding site for residue UTP A 501 source : AC1 2) chain A residue 54 type sequence S description binding site for residue UTP A 501 source : AC1 3) chain A residue 65 type sequence S description binding site for residue UTP A 501 source : AC1 4) chain A residue 66 type sequence D description binding site for residue UTP A 501 source : AC1 5) chain A residue 68 type sequence D description binding site for residue UTP A 501 source : AC1 6) chain A residue 144 type sequence G description binding site for residue UTP A 501 source : AC1 7) chain A residue 147 type sequence N description binding site for residue UTP A 501 source : AC1 8) chain A residue 148 type sequence S description binding site for residue UTP A 501 source : AC1 9) chain A residue 169 type sequence K description binding site for residue UTP A 501 source : AC1 10) chain A residue 173 type sequence K description binding site for residue UTP A 501 source : AC1 11) chain A residue 188 type sequence S description binding site for residue UTP A 501 source : AC1 12) chain A residue 189 type sequence Y description binding site for residue UTP A 501 source : AC1 13) chain A residue 66 type sequence D description binding site for residue MG A 502 source : AC2 14) chain A residue 68 type sequence D description binding site for residue MG A 502 source : AC2 15) chain A residue 54 type BINDING sequence S description BINDING => ECO:0000269|PubMed:17189640, ECO:0000269|PubMed:17785418, ECO:0000269|PubMed:27744351, ECO:0007744|PDB:2IKF, ECO:0007744|PDB:2Q0F, ECO:0007744|PDB:5KAL source Swiss-Prot : SWS_FT_FI1 16) chain A residue 65 type BINDING sequence S description BINDING => ECO:0000269|PubMed:17189640, ECO:0000269|PubMed:17785418, ECO:0000269|PubMed:27744351, ECO:0007744|PDB:2IKF, ECO:0007744|PDB:2Q0F, ECO:0007744|PDB:5KAL source Swiss-Prot : SWS_FT_FI1 17) chain A residue 144 type BINDING sequence G description BINDING => ECO:0000269|PubMed:17189640, ECO:0000269|PubMed:17785418, ECO:0000269|PubMed:27744351, ECO:0007744|PDB:2IKF, ECO:0007744|PDB:2Q0F, ECO:0007744|PDB:5KAL source Swiss-Prot : SWS_FT_FI1 18) chain A residue 169 type BINDING sequence K description BINDING => ECO:0000269|PubMed:17189640, ECO:0000269|PubMed:17785418, ECO:0000269|PubMed:27744351, ECO:0007744|PDB:2IKF, ECO:0007744|PDB:2Q0F, ECO:0007744|PDB:5KAL source Swiss-Prot : SWS_FT_FI1 19) chain A residue 173 type BINDING sequence K description BINDING => ECO:0000269|PubMed:17189640, ECO:0000269|PubMed:17785418, ECO:0000269|PubMed:27744351, ECO:0007744|PDB:2IKF, ECO:0007744|PDB:2Q0F, ECO:0007744|PDB:5KAL source Swiss-Prot : SWS_FT_FI1 20) chain A residue 188 type BINDING sequence S description BINDING => ECO:0000269|PubMed:17189640, ECO:0000269|PubMed:17785418, ECO:0000269|PubMed:27744351, ECO:0007744|PDB:2IKF, ECO:0007744|PDB:2Q0F, ECO:0007744|PDB:5KAL source Swiss-Prot : SWS_FT_FI1 21) chain A residue 66 type BINDING sequence D description BINDING => ECO:0000269|PubMed:17189640, ECO:0000269|PubMed:17785418, ECO:0000269|PubMed:27744351, ECO:0007744|PDB:2IKF, ECO:0007744|PDB:2NOM, ECO:0007744|PDB:2Q0C, ECO:0007744|PDB:2Q0D, ECO:0007744|PDB:2Q0E, ECO:0007744|PDB:2Q0F, ECO:0007744|PDB:2Q0G, ECO:0007744|PDB:5KAL source Swiss-Prot : SWS_FT_FI2 22) chain A residue 68 type BINDING sequence D description BINDING => ECO:0000269|PubMed:17189640, ECO:0000269|PubMed:17785418, ECO:0000269|PubMed:27744351, ECO:0007744|PDB:2IKF, ECO:0007744|PDB:2NOM, ECO:0007744|PDB:2Q0C, ECO:0007744|PDB:2Q0D, ECO:0007744|PDB:2Q0E, ECO:0007744|PDB:2Q0F, ECO:0007744|PDB:2Q0G, ECO:0007744|PDB:5KAL source Swiss-Prot : SWS_FT_FI2 23) chain A residue 121 type BINDING sequence R description BINDING => ECO:0000269|PubMed:17785418, ECO:0000269|PubMed:27744351, ECO:0007744|PDB:2Q0F, ECO:0007744|PDB:2Q0G, ECO:0007744|PDB:5KAL source Swiss-Prot : SWS_FT_FI3 24) chain A residue 136 type SITE sequence D description Important for catalytic activity => ECO:0000269|PubMed:17189640 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links