eF-site ID 5jvg-J PDB Code 5jvg Chain J click to enlarge Title The large ribosomal subunit from Deinococcus radiodurans in complex with avilamycin Classification RIBOSOME Compound 23S ribosomal RNA Source ORGANISM_SCIENTIFIC: Deinococcus radiodurans R1; Sequence J:  KRTKFRKQFRGRMTGDAKGGDYVAFGDYGLIAMEPAWIKS NQIEACRIVMSRHFRRGGKIYIRIFPDKPVTKKPAETRMG KGKGAVEYWVSVVKPGRVMFEVAGVTEEQAKEAFRLAGHK LPIQTKMVKREVYDEA Description Functional site 1) chain J residue 52 type sequence R description binding site for residue 6NO X 2901 source : AC1 2) chain J residue 53 type sequence I description binding site for residue 6NO X 2901 source : AC1 3) chain J residue 56 type sequence S description binding site for residue 6NO X 2901 source : AC1 4) chain J residue 57 type sequence R description binding site for residue 6NO X 2901 source : AC1 5) chain J residue 61 type sequence R description binding site for residue 6NO X 2901 source : AC1 6) chain J residue 84 type sequence M description binding site for residue MG J 201 source : BU4 7) chain J residue 60-71 type prosite sequence RRGGKIYIRIFP description RIBOSOMAL_L16_1 Ribosomal protein L16 signature 1. RRgGKIYIRIFP source prosite : PS00586 8) chain J residue 83-94 type prosite sequence RMGKGKGAVEYW description RIBOSOMAL_L16_2 Ribosomal protein L16 signature 2. RMGkGKGaveyW source prosite : PS00701

Display surface Download Links