eF-site ID 5jmr-AB PDB Code 5jmr Chain A, B click to enlarge Title X-ray structure of the furin inhibitory antibody Nb14 Classification IMMUNE SYSTEM Compound camelid VHH fragment Source (5JMR) Sequence A:  QVQLQESGGGLVQPGGSLTLSCAASGFTFSSYSMYWVRQA PGKGLEWVSSINRVGSNTDYADSVKGRFTISRDNAKNTLY LQMNSLKSEDTALYYCAVGMYAAPPWRGQGTQVTVSS B:  QVQLQESGGGLVQPGGSLTLSCAASGFTFSSYSMYWVRQA PGKGLEWVSSINRVGSNTDYADSVKGRFTISRDNAKNTLY LQMNSLKSEDTALYYCAVGMYAAPPWRGQGTQVTVS Description Functional site 1) chain A residue 39 type sequence Q description binding site for residue CL A 201 source : AC1 2) chain A residue 42 type sequence G description binding site for residue CL A 201 source : AC1 3) chain B residue 71 type sequence S description binding site for residue CL A 201 source : AC1 4) chain B residue 72 type sequence R description binding site for residue CL A 201 source : AC1 5) chain A residue 71 type sequence S description binding site for residue CL B 201 source : AC2 6) chain A residue 72 type sequence R description binding site for residue CL B 201 source : AC2 7) chain B residue 42 type sequence G description binding site for residue CL B 201 source : AC2 8) chain B residue 44 type sequence G description binding site for residue CL B 201 source : AC2

Display surface Download Links