eF-site ID 5j9q-K
PDB Code 5j9q
Chain K

click to enlarge
Title Crystal structure of the NuA4 core complex
Classification TRANSFERASE
Compound Histone acetyltransferase ESA1
Source Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (5J9Q)
Sequence K:  MDPSLVLEQTIQDVSNLPSEFRYLLEEIGSNDLKLIEEKK
KYEQKESQIHKFIRQQGSIPKHPQEDGLDKEIKESLLKCQ
SLQREKCVLANTALFLIARHLNKLEKNIALLEEDGVLAPV
Description (1)  Histone acetyltransferase ESA1 (E.C.2.3.1.48), Chromatin modification-related protein EAF6, Enhancer of polycomb-like protein 1, Chromatin modification-related protein YNG2, Htz1

Display surface

Download
Links