eF-site ID 5j9q-A
PDB Code 5j9q
Chain A

click to enlarge
Title Crystal structure of the NuA4 core complex
Classification TRANSFERASE
Compound Histone acetyltransferase ESA1
Source Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (5J9Q)
Sequence A:  MTQNPHEVARVRNLNRIIMGKYEIEPWYFSPYPIELTDED
FIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDY
VSFFEIDGRKQRTWCRNLCLLSKLFLDHXTLYYDVDPFLF
YCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQR
MGYGKLLIEFSYELSKKENKVGSPQKPLSDLGLLSYRAYW
SDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNI
LRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKP
PVFTASQLRFAW
Description (1)  Histone acetyltransferase ESA1 (E.C.2.3.1.48), Chromatin modification-related protein EAF6, Enhancer of polycomb-like protein 1, Chromatin modification-related protein YNG2, Htz1


Functional site

1) chain A
residue 198
type ACT_SITE
ligand
sequence D
description Proton donor/acceptor. {ECO:0000303|PubMed:12368900, ECO:0000303|PubMed:17223684, ECO:0000303|PubMed:18245364, ECO:0000303|PubMed:22020126, ECO:0000305}.
source Swiss-Prot : SWS_FT_FI4

2) chain A
residue 202
type BINDING
ligand
sequence L
description Acetyl-CoA. {ECO:0000269|PubMed:11106757, ECO:0000269|PubMed:12368900, ECO:0000269|PubMed:22020126}.
source Swiss-Prot : SWS_FT_FI5

3) chain A
residue 164
type SITE
ligand
sequence V
description Important for catalytic activity. {ECO:0000305}.
source Swiss-Prot : SWS_FT_FI6

4) chain A
residue 252
type binding
ligand ALY: N(6)-ACETYLLYSINE
sequence C
description N(6)-ACETYLLYSINE binding site
source pdb_hetatom : ALY_5j9q_A_262

5) chain A
residue 255-256
type binding
ligand ALY: N(6)-ACETYLLYSINE
sequence SK
description N(6)-ACETYLLYSINE binding site
source pdb_hetatom : ALY_5j9q_A_262

6) chain A
residue 259-261
type binding
ligand ALY: N(6)-ACETYLLYSINE
sequence LDH
description N(6)-ACETYLLYSINE binding site
source pdb_hetatom : ALY_5j9q_A_262

7) chain A
residue 263-264
type binding
ligand ALY: N(6)-ACETYLLYSINE
sequence TL
description N(6)-ACETYLLYSINE binding site
source pdb_hetatom : ALY_5j9q_A_262

8) chain A
residue 271
type binding
ligand ALY: N(6)-ACETYLLYSINE
sequence F
description N(6)-ACETYLLYSINE binding site
source pdb_hetatom : ALY_5j9q_A_262

9) chain A
residue 273
type binding
ligand ALY: N(6)-ACETYLLYSINE
sequence F
description N(6)-ACETYLLYSINE binding site
source pdb_hetatom : ALY_5j9q_A_262

10) chain A
residue 289
type binding
ligand ALY: N(6)-ACETYLLYSINE
sequence Y
description N(6)-ACETYLLYSINE binding site
source pdb_hetatom : ALY_5j9q_A_262

11) chain A
residue 291
type binding
ligand ALY: N(6)-ACETYLLYSINE
sequence S
description N(6)-ACETYLLYSINE binding site
source pdb_hetatom : ALY_5j9q_A_262

12) chain A
residue 303-304
type binding
ligand ALY: N(6)-ACETYLLYSINE
sequence AC
description N(6)-ACETYLLYSINE binding site
source pdb_hetatom : ALY_5j9q_A_262


Display surface

Download
Links