eF-site ID 5j37-D PDB Code 5j37 Chain D click to enlarge Title Crystal structure of 60-mer BFDV Capsid Protein in complex with single stranded DNA Classification VIRUS/DNA Compound Beak and feather disease virus capsid protein Source null (5J37) Sequence D:  FSTNRIYTLRLTRQFQFKINKQTTSVGNLIFNADYITFAL DDFLQAVPNPHTLNFEDYRIKLAKMEMRPTGGHYTVQSDG FGHTAVIQDSRITRFKTTADQTQDPLAPFDGAKKWFVSRG FKRLLRPKPQITIEDLTTANQSAALWLNSARTGWIPLQGG PNSAGTKVRHYGIAFSFPQPEQTITYVTKLTLYVQFRQFA PNNPST Description Functional site 1) chain D residue 43 type sequence S description binding site for residue PO4 D 301 source : AC5 2) chain D residue 44 type sequence T description binding site for residue PO4 D 301 source : AC5 3) chain D residue 152 type sequence G description binding site for residue PO4 D 301 source : AC5 4) chain D residue 154 type sequence K description binding site for residue PO4 D 301 source : AC5 5) chain D residue 164 type sequence R description binding site for residue PO4 D 301 source : AC5

Display surface Download Links