eF-site ID 5j37-A PDB Code 5j37 Chain A click to enlarge Title Crystal structure of 60-mer BFDV Capsid Protein in complex with single stranded DNA Classification VIRUS/DNA Compound Beak and feather disease virus capsid protein Source Beak and feather disease virus (BFDV) (5J37) Sequence A:  FSTNRIYTLRLTRQFQFKINKQTTSVGNLIFNADYITFAL DDFLQAVPNPHTLNFEDYRIKLAKMEMRPTGGHYTVQSDG FGHTAVIQDSRITRFKTTADQTQDPLAPFDGAKKWFVSRG FKRLLRPKPQITIEDLTTANQSAALWLNSARTGWIPLQGG PNSAGTKVRHYGIAFSFPQPEQTITYVTKLTLYVQFRQFA PNNPST Description Functional site 1) chain A residue 43 type sequence S description binding site for residue PO4 A 301 source : AC2 2) chain A residue 44 type sequence T description binding site for residue PO4 A 301 source : AC2 3) chain A residue 154 type sequence K description binding site for residue PO4 A 301 source : AC2 4) chain A residue 164 type sequence R description binding site for residue PO4 A 301 source : AC2

Display surface Download Links