eF-site ID 5j31-B PDB Code 5j31 Chain B click to enlarge Title Crystal structure of 14-3-3zeta in complex with an alkyne cross-linked cyclic peptide derived from ExoS Classification SIGNALING PROTEIN Compound 14-3-3 protein zeta/delta Source Homo sapiens (Human) (Q93SQ3_PSEAI) Sequence B:  MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEE RNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAR EYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLK MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEM QPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAI AELDTLEESYKDSTLIMQLLRDNLTLWTS Description Functional site 1) chain B residue 219 type sequence Q description binding site for residue BEZ B 301 source : AC1 2) chain B residue 222 type sequence R description binding site for residue BEZ B 301 source : AC1 3) chain B residue 41 type sequence R description binding site for Di-peptide ASP D 424 and ZS8 D 425 source : AC4 4) chain B residue 42 type sequence N description binding site for Di-peptide ASP D 424 and ZS8 D 425 source : AC4 5) chain B residue 49 type sequence K description binding site for Di-peptide ASP D 424 and ZS8 D 425 source : AC4 6) chain B residue 117 type sequence F description binding site for Di-peptide ASP D 424 and ZS8 D 425 source : AC4 7) chain B residue 41 type sequence R description binding site for Di-peptide ZS8 D 425 and LEU D 426 source : AC5 8) chain B residue 42 type sequence N description binding site for Di-peptide ZS8 D 425 and LEU D 426 source : AC5 9) chain B residue 117 type sequence F description binding site for Di-peptide ZS8 D 425 and LEU D 426 source : AC5 10) chain B residue 120 type sequence K description binding site for Di-peptide ZS8 D 425 and LEU D 426 source : AC5 11) chain B residue 3 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 12) chain B residue 68 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 13) chain B residue 56 type SITE sequence R description Interaction with phosphoserine on interacting protein => ECO:0000250|UniProtKB:P63103 source Swiss-Prot : SWS_FT_FI1 14) chain B residue 127 type SITE sequence R description Interaction with phosphoserine on interacting protein => ECO:0000250|UniProtKB:P63103 source Swiss-Prot : SWS_FT_FI1 15) chain B residue 210 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P63102 source Swiss-Prot : SWS_FT_FI7 16) chain B residue 1 type MOD_RES sequence M description N-acetylmethionine => ECO:0000269|Ref.8, ECO:0007744|PubMed:22223895, ECO:0007744|PubMed:22814378, ECO:0007744|PubMed:25944712 source Swiss-Prot : SWS_FT_FI2 17) chain B residue 58 type MOD_RES sequence S description Phosphoserine; by PKA and PKB/AKT1 => ECO:0000269|PubMed:11956222, ECO:0000269|PubMed:12865427, ECO:0000269|PubMed:15883165, ECO:0000269|PubMed:16376338 source Swiss-Prot : SWS_FT_FI4 18) chain B residue 184 type MOD_RES sequence S description Phosphoserine; by MAPK8 => ECO:0000269|PubMed:15071501, ECO:0000269|PubMed:15696159 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links