eF-site ID 5j0x-A
PDB Code 5j0x
Chain A

click to enlarge
Title Binary complex crystal structure of DNA polymerase Beta with T:G mismatch at the primer terminus
Classification TRANSFERASE/DNA
Compound DNA polymerase beta
Source Homo sapiens (Human) (5J0X)
Sequence A:  APQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASV
IAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKL
EKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDL
RKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNE
VKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSEST
PKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDE
KEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHAL
EKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKY
REPKDRSE
Description (1)  DNA polymerase beta/DNA Complex


Functional site

1) chain A
residue 101
type
ligand
sequence T
description binding site for residue NA A 401
source : AC1

2) chain A
residue 103
type
ligand
sequence V
description binding site for residue NA A 401
source : AC1

3) chain A
residue 106
type
ligand
sequence I
description binding site for residue NA A 401
source : AC1

4) chain A
residue 60
type
ligand
sequence K
description binding site for residue NA A 402
source : AC2

5) chain A
residue 62
type
ligand
sequence L
description binding site for residue NA A 402
source : AC2

6) chain A
residue 65
type
ligand
sequence V
description binding site for residue NA A 402
source : AC2

7) chain A
residue 30
type
ligand
sequence S
description binding site for residue NA A 403
source : AC3

8) chain A
residue 171
type
ligand
sequence S
description binding site for residue NA A 403
source : AC3

9) chain A
residue 101
type
ligand
sequence T
description binding site for residue NA A 404
source : AC4

10) chain A
residue 72
type ACT_SITE
ligand
sequence K
description Schiff-base intermediate with DNA.
source Swiss-Prot : SWS_FT_FI1

11) chain A
residue 190
type METAL
ligand
sequence D
description Magnesium 1
source Swiss-Prot : SWS_FT_FI2

12) chain A
residue 192
type METAL
ligand
sequence D
description Magnesium 1
source Swiss-Prot : SWS_FT_FI2

13) chain A
residue 101
type METAL
ligand
sequence T
description Sodium; via carbonyl oxygen
source Swiss-Prot : SWS_FT_FI3

14) chain A
residue 103
type METAL
ligand
sequence V
description Sodium; via carbonyl oxygen
source Swiss-Prot : SWS_FT_FI3

15) chain A
residue 106
type METAL
ligand
sequence I
description Sodium; via carbonyl oxygen
source Swiss-Prot : SWS_FT_FI3

16) chain A
residue 190
type METAL
ligand
sequence D
description Magnesium 2
source Swiss-Prot : SWS_FT_FI4

17) chain A
residue 192
type METAL
ligand
sequence D
description Magnesium 2
source Swiss-Prot : SWS_FT_FI4

18) chain A
residue 256
type METAL
ligand
sequence D
description Magnesium 2
source Swiss-Prot : SWS_FT_FI4


Display surface

Download
Links