eF-site ID 5j0x-A PDB Code 5j0x Chain A click to enlarge Title Binary complex crystal structure of DNA polymerase Beta with T:G mismatch at the primer terminus Classification TRANSFERASE/DNA Compound DNA polymerase beta Source Homo sapiens (Human) (5J0X) Sequence A:  APQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASV IAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKL EKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDL RKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNE VKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSEST PKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDE KEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHAL EKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKY REPKDRSE Description Functional site 1) chain A residue 101 type sequence T description binding site for residue NA A 401 source : AC1 2) chain A residue 103 type sequence V description binding site for residue NA A 401 source : AC1 3) chain A residue 106 type sequence I description binding site for residue NA A 401 source : AC1 4) chain A residue 60 type sequence K description binding site for residue NA A 402 source : AC2 5) chain A residue 62 type sequence L description binding site for residue NA A 402 source : AC2 6) chain A residue 65 type sequence V description binding site for residue NA A 402 source : AC2 7) chain A residue 30 type sequence S description binding site for residue NA A 403 source : AC3 8) chain A residue 171 type sequence S description binding site for residue NA A 403 source : AC3 9) chain A residue 101 type sequence T description binding site for residue NA A 404 source : AC4 10) chain A residue 179-198 type prosite sequence GSFRRGAESSGDMDVLLTHP description DNA_POLYMERASE_X DNA polymerase family X signature. GSFrRGaesSgDMDVLLthP source prosite : PS00522

Display surface Download Links