eF-site ID 5j0x-A PDB Code 5j0x Chain A click to enlarge Title Binary complex crystal structure of DNA polymerase Beta with T:G mismatch at the primer terminus Classification TRANSFERASE/DNA Compound DNA polymerase beta Source Homo sapiens (Human) (5J0X) Sequence A:  APQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASV IAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKL EKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDL RKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNE VKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSEST PKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDE KEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHAL EKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKY REPKDRSE Description (1)  DNA polymerase beta/DNA Complex Functional site 1) chain A residue 101 type ligand sequence T description binding site for residue NA A 401 source : AC1 2) chain A residue 103 type ligand sequence V description binding site for residue NA A 401 source : AC1 3) chain A residue 106 type ligand sequence I description binding site for residue NA A 401 source : AC1 4) chain A residue 60 type ligand sequence K description binding site for residue NA A 402 source : AC2 5) chain A residue 62 type ligand sequence L description binding site for residue NA A 402 source : AC2 6) chain A residue 65 type ligand sequence V description binding site for residue NA A 402 source : AC2 7) chain A residue 30 type ligand sequence S description binding site for residue NA A 403 source : AC3 8) chain A residue 171 type ligand sequence S description binding site for residue NA A 403 source : AC3 9) chain A residue 101 type ligand sequence T description binding site for residue NA A 404 source : AC4 10) chain A residue 72 type ACT_SITE ligand sequence K description Schiff-base intermediate with DNA. source Swiss-Prot : SWS_FT_FI1 11) chain A residue 190 type METAL ligand sequence D description Magnesium 1 source Swiss-Prot : SWS_FT_FI2 12) chain A residue 192 type METAL ligand sequence D description Magnesium 1 source Swiss-Prot : SWS_FT_FI2 13) chain A residue 101 type METAL ligand sequence T description Sodium; via carbonyl oxygen source Swiss-Prot : SWS_FT_FI3 14) chain A residue 103 type METAL ligand sequence V description Sodium; via carbonyl oxygen source Swiss-Prot : SWS_FT_FI3 15) chain A residue 106 type METAL ligand sequence I description Sodium; via carbonyl oxygen source Swiss-Prot : SWS_FT_FI3 16) chain A residue 190 type METAL ligand sequence D description Magnesium 2 source Swiss-Prot : SWS_FT_FI4 17) chain A residue 192 type METAL ligand sequence D description Magnesium 2 source Swiss-Prot : SWS_FT_FI4 18) chain A residue 256 type METAL ligand sequence D description Magnesium 2 source Swiss-Prot : SWS_FT_FI4 19) chain A residue 179-198 type prosite ligand sequence GSFRRGAESSGDMDVLLTHP description DNA polymerase family X signature.G-[SG]-[LFY]-x-R-[GE]-x(3)-[SGCL]-x-D-[LIVM]-D-[LIVMFY](3)-x(2)-[SAP]. source prosite : PS00522

Display surface Download Links