eF-site ID 5iqp-A PDB Code 5iqp Chain A click to enlarge Title 14-3-3 PROTEIN TAU ISOFORM Classification SIGNALING PROTEIN Compound 14-3-3 protein theta Source Homo sapiens (Human) (1433T_HUMAN) Sequence A:  MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEE RNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIK DYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK MKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEM QPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAI AELDTLNEDSYKDSTLIMQLLRDNLTLWTS Description (1)  14-3-3 protein theta Functional site 1) chain A residue 49 type sequence K description binding site for residue SO4 A 301 source : AC1 2) chain A residue 56 type sequence R description binding site for residue SO4 A 301 source : AC1 3) chain A residue 127 type sequence R description binding site for residue SO4 A 301 source : AC1 4) chain A residue 128 type sequence Y description binding site for residue SO4 A 301 source : AC1 5) chain A residue 3 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 6) chain A residue 68 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 7) chain A residue 115 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 8) chain A residue 1 type MOD_RES sequence M description N-acetylmethionine => ECO:0000269|Ref.8, ECO:0007744|PubMed:22814378, ECO:0007744|PubMed:25944712 source Swiss-Prot : SWS_FT_FI2 9) chain A residue 56 type SITE sequence R description Interaction with phosphoserine on interacting protein source Swiss-Prot : SWS_FT_FI1 10) chain A residue 127 type SITE sequence R description Interaction with phosphoserine on interacting protein source Swiss-Prot : SWS_FT_FI1 11) chain A residue 41-51 type prosite sequence RNLLSVAYKNV description 1433_1 14-3-3 proteins signature 1. RNLLSVAYKNV source prosite : PS00796 12) chain A residue 211-230 type prosite sequence YKDSTLIMQLLRDNLTLWTS description 1433_2 14-3-3 proteins signature 2. YKDSTLIMQLLRDNLTLWTS source prosite : PS00797 13) chain A residue 49 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI8 14) chain A residue 49 type MOD_RES sequence K description N6-acetyllysine; alternate => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI4 15) chain A residue 82 type MOD_RES sequence Y description 3'-nitrotyrosine => ECO:0000250|UniProtKB:Q9CQV8 source Swiss-Prot : SWS_FT_FI5 16) chain A residue 104 type MOD_RES sequence Y description 3'-nitrotyrosine => ECO:0000250|UniProtKB:Q9CQV8 source Swiss-Prot : SWS_FT_FI5 17) chain A residue 92 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P68254 source Swiss-Prot : SWS_FT_FI6

Display surface Download Links