eF-site ID 5i3j-A PDB Code 5i3j Chain A click to enlarge Title Structure-Function Studies on Role of Hydrophobic Clamping of a Basic Glutamate in Catalysis by Triosephosphate Isomerase Classification ISOMERASE Compound Triosephosphate isomerase, glycosomal Source Trypanosoma brucei brucei (TPIS_TRYBB) Sequence A:  SKPQPIAAANWKCNGSQQSLSELIDLFNSTSINHDVQCVV ASTFVHLAMTKERLSHPKFVIAAQNAIAKSGAFTGEVSLP ILKDFGVNWIVLGHSERRAYYGETNEIVADKVAAAVASGF MVIACIGETLQERESGRTAVVVLTQIAAIAKKLKKADWAK VVIAYEPVWAIGTGKVATPQQAQEAHALIRSWVSSKIGAD VAGELRILYGGSVNGKNARTLYQQRDVNGFAVGGASLKPE FVDIIKATQ Description Functional site 1) chain A residue 22 type sequence S description binding site for residue NA A 301 source : AC1 2) chain A residue 54 type sequence R description binding site for residue NA A 301 source : AC1 3) chain A residue 152 type sequence K description binding site for residue NA A 301 source : AC1 4) chain A residue 22 type sequence S description binding site for residue NA A 302 source : AC2 5) chain A residue 25 type sequence I description binding site for residue NA A 302 source : AC2 6) chain A residue 54 type sequence R description binding site for residue NA A 302 source : AC2 7) chain A residue 152 type sequence K description binding site for residue NA A 302 source : AC2 8) chain A residue 221 type sequence T description binding site for residue NA A 303 source : AC3 9) chain A residue 224 type sequence Q description binding site for residue NA A 304 source : AC4 10) chain A residue 165-175 type prosite sequence AYEPVWAIGTG description TIM_1 Triosephosphate isomerase active site. AYEPVWAIGTG source prosite : PS00171 11) chain A residue 95 type ACT_SITE sequence H description Electrophile source Swiss-Prot : SWS_FT_FI1 12) chain A residue 167 type ACT_SITE sequence E description Proton acceptor source Swiss-Prot : SWS_FT_FI2 13) chain A residue 11 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI3 14) chain A residue 13 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI3

Display surface Download Links