eF-site ID 5i3i-C PDB Code 5i3i Chain C click to enlarge Title Structure-Function Studies on Role of Hydrophobic Clamping of a Basic Glutamate in Catalysis by Triosephosphate Isomerase Classification ISOMERASE Compound Triosephosphate isomerase, glycosomal Source Trypanosoma brucei brucei (TPIS_TRYBB) Sequence C:  SKPQPIAAANWKCNGSQQSLSELIDLFNSTSINHDVQCVV ASTFVHLAMTKERLSHPKFVIAAQNAIAKSGAFTGEVSLP ILKDFGVNWIVLGHSERRAYYGETNEIVADKVAAAVASGF MVIACIGETLQERESGRTAVVVLTQIAAIAKKLKKADWAK VVIAYEPVWAAGTGKVATPQQAQEAHALIRSWVSSKIGAD VAGELRILYGGSVNGKNARTLYQQRDVNGFLVGGASLKPE FVDIIKATQ Description Functional site 1) chain C residue 11 type sequence N description binding site for residue PGA C 301 source : AC3 2) chain C residue 13 type sequence K description binding site for residue PGA C 301 source : AC3 3) chain C residue 95 type sequence H description binding site for residue PGA C 301 source : AC3 4) chain C residue 167 type sequence E description binding site for residue PGA C 301 source : AC3 5) chain C residue 171 type sequence A description binding site for residue PGA C 301 source : AC3 6) chain C residue 173 type sequence G description binding site for residue PGA C 301 source : AC3 7) chain C residue 212 type sequence G description binding site for residue PGA C 301 source : AC3 8) chain C residue 213 type sequence S description binding site for residue PGA C 301 source : AC3 9) chain C residue 234 type sequence G description binding site for residue PGA C 301 source : AC3 10) chain C residue 235 type sequence G description binding site for residue PGA C 301 source : AC3 11) chain C residue 95 type ACT_SITE sequence H description Electrophile source Swiss-Prot : SWS_FT_FI1 12) chain C residue 167 type ACT_SITE sequence E description Proton acceptor source Swiss-Prot : SWS_FT_FI2 13) chain C residue 11 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI3 14) chain C residue 13 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI3

Display surface Download Links