eF-site ID 5i3i-B PDB Code 5i3i Chain B click to enlarge Title Structure-Function Studies on Role of Hydrophobic Clamping of a Basic Glutamate in Catalysis by Triosephosphate Isomerase Classification ISOMERASE Compound Triosephosphate isomerase, glycosomal Source Trypanosoma brucei brucei (TPIS_TRYBB) Sequence B:  SKPQPIAAANWKCNGSQQSLSELIDLFNSTSINHDVQCVV ASTFVHLAMTKERLSHPKFVIAAQNAIAKSGAFTGEVSLP ILKDFGVNWIVLGHSERRAYYGETNEIVADKVAAAVASGF MVIACIGETLQERESGRTAVVVLTQIAAIAKKLKKADWAK VVIAYEPVWAAGTGKVATPQQAQEAHALIRSWVSSKIGAD VAGELRILYGGSVNGKNARTLYQQRDVNGFLVGGASLKPE FVDIIKATQ Description Functional site 1) chain B residue 11 type sequence N description binding site for residue PGA B 301 source : AC2 2) chain B residue 13 type sequence K description binding site for residue PGA B 301 source : AC2 3) chain B residue 95 type sequence H description binding site for residue PGA B 301 source : AC2 4) chain B residue 167 type sequence E description binding site for residue PGA B 301 source : AC2 5) chain B residue 171 type sequence A description binding site for residue PGA B 301 source : AC2 6) chain B residue 172 type sequence A description binding site for residue PGA B 301 source : AC2 7) chain B residue 173 type sequence G description binding site for residue PGA B 301 source : AC2 8) chain B residue 212 type sequence G description binding site for residue PGA B 301 source : AC2 9) chain B residue 213 type sequence S description binding site for residue PGA B 301 source : AC2 10) chain B residue 234 type sequence G description binding site for residue PGA B 301 source : AC2 11) chain B residue 235 type sequence G description binding site for residue PGA B 301 source : AC2 12) chain B residue 95 type ACT_SITE sequence H description Electrophile source Swiss-Prot : SWS_FT_FI1 13) chain B residue 167 type ACT_SITE sequence E description Proton acceptor source Swiss-Prot : SWS_FT_FI2 14) chain B residue 11 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI3 15) chain B residue 13 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI3

Display surface Download Links