eF-site ID 5i3h-AB PDB Code 5i3h Chain A, B click to enlarge Title Structure-Function Studies on Role of Hydrophobic Clamping of a Basic Glutamate in Catalysis by Triosephosphate Isomerase Classification ISOMERASE Compound Triosephosphate isomerase, glycosomal Source Trypanosoma brucei brucei (TPIS_TRYBB) Sequence A:  SKPQPIAAANWKCNGSQQSLSELIDLFNSTSINHDVQCVV ASTFVHLAMTKERLSHPKFVIAAQNAIAKSGAFTGEVSLP ILKDFGVNWIVLGHSERRAYYGETNEIVADKVAAAVASGF MVIACIGETLQERESGRTAVVVLTQIAAIAKKLKKADWAK VVIAYEPVWAAGTGKVATPQQAQEAHALIRSWVSSKIGAD VAGELRILYGGSVNGKNARTLYQQRDVNGFAVGGASLKPE FVDIIKATQ B:  SKPQPIAAANWKCNGSQQSLSELIDLFNSTSINHDVQCVV ASTFVHLAMTKERLSHPKFVIAAQNAIAKSGAFTGEVSLP ILKDFGVNWIVLGHSERRAYYGETNEIVADKVAAAVASGF MVIACIGETLQERESGRTAVVVLTQIAAIAKKLKKADWAK VVIAYEPVWAAGTGKVATPQQAQEAHALIRSWVSSKIGAD VAGELRILYGGSVNGKNARTLYQQRDVNGFAVGGASLKPE FVDIIKATQ Description Functional site 1) chain A residue 214 type sequence V description binding site for residue K A 301 source : AC1 2) chain A residue 236 type sequence A description binding site for residue K A 301 source : AC1 3) chain A residue 15 type sequence N description binding site for residue K A 302 source : AC2 4) chain B residue 72 type sequence G description binding site for residue K A 302 source : AC2 5) chain B residue 73 type sequence A description binding site for residue K A 302 source : AC2 6) chain B residue 13 type sequence K description binding site for residue PGA B 301 source : AC3 7) chain B residue 95 type sequence H description binding site for residue PGA B 301 source : AC3 8) chain B residue 167 type sequence E description binding site for residue PGA B 301 source : AC3 9) chain B residue 171 type sequence A description binding site for residue PGA B 301 source : AC3 10) chain B residue 172 type sequence A description binding site for residue PGA B 301 source : AC3 11) chain B residue 173 type sequence G description binding site for residue PGA B 301 source : AC3 12) chain B residue 213 type sequence S description binding site for residue PGA B 301 source : AC3 13) chain B residue 234 type sequence G description binding site for residue PGA B 301 source : AC3 14) chain B residue 235 type sequence G description binding site for residue PGA B 301 source : AC3 15) chain B residue 95 type ACT_SITE sequence H description Electrophile source Swiss-Prot : SWS_FT_FI1 16) chain A residue 95 type ACT_SITE sequence H description Electrophile source Swiss-Prot : SWS_FT_FI1 17) chain B residue 167 type ACT_SITE sequence E description Proton acceptor source Swiss-Prot : SWS_FT_FI2 18) chain A residue 167 type ACT_SITE sequence E description Proton acceptor source Swiss-Prot : SWS_FT_FI2 19) chain B residue 11 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI3 20) chain B residue 13 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI3 21) chain A residue 11 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI3 22) chain A residue 13 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI3

Display surface Download Links