eF-site ID 5hwv-AB PDB Code 5hwv Chain A, B click to enlarge Title Crystal structure of PAS1 complexed with toluene Classification TRANSFERASE Compound Sensor histidine kinase TodS Source Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1) (TODS_PSEP1) Sequence A:  ALYEFVGLLDAHGNVLEVNQVALEGGGITXEEIRGKPFWK ARWWQISKKTEATQKRLVETASSGEFVRCDVEILGKSGGR EVIAVDFSLLPICNEEGSIVYLLAEGRNITDKKKAEAXLA LKNQ B:  LYEFVGLLDAHGNVLEVNQVALEGGGITXEEIRGKPFWKA RWWQISKKTEATQKRLVETASSGEFVRCDVEILGKSGGRE VIAVDFSLLPICNEEGSIVYLLAEGRNITDKKKAEAXLAL KNQEL Description (1)  Sensor histidine kinase TodS (E.C.2.7.13.3) Functional site 1) chain A residue 146 type sequence E description binding site for residue MBN A 501 source : AC1 2) chain A residue 147 type sequence G description binding site for residue MBN A 501 source : AC1 3) chain B residue 47 type sequence V description binding site for residue MBN B 201 source : AC2 4) chain B residue 48 type sequence G description binding site for residue MBN B 201 source : AC2 5) chain B residue 79 type sequence F description binding site for residue MBN B 201 source : AC2 6) chain B residue 84 type sequence W description binding site for residue MBN B 201 source : AC2 7) chain B residue 85 type sequence W description binding site for residue MBN B 201 source : AC2 8) chain B residue 114 type sequence I description binding site for residue MBN B 201 source : AC2

Display surface Download Links