eF-site ID 5hoa-A PDB Code 5hoa Chain A click to enlarge Title Crystal structure of c-Met L1195V in complex with SAR125844 Classification TRANSFERASE Compound Hepatocyte growth factor receptor Source Homo sapiens (Human) (MET_HUMAN) Sequence A:  AVQHVVVYHGTLKIHCAVKQFLTEGIIMKDFSHPNVLSLL GVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKF VASKKFVHRDLAARNCMLDEKFTVKVADFGLARLPVKWMA LESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFD ITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMRPSFS ELVSRISAIFSTFIGEHYVHVNATY Description (1)  Hepatocyte growth factor receptor (E.C.2.7.10.1) Functional site 1) chain A residue 1157 type sequence L description binding site for residue 63K A 1401 source : AC1 2) chain A residue 1159 type sequence Y description binding site for residue 63K A 1401 source : AC1 3) chain A residue 1160 type sequence M description binding site for residue 63K A 1401 source : AC1 4) chain A residue 1161 type sequence K description binding site for residue 63K A 1401 source : AC1 5) chain A residue 1163 type sequence G description binding site for residue 63K A 1401 source : AC1 6) chain A residue 1164 type sequence D description binding site for residue 63K A 1401 source : AC1 7) chain A residue 1167 type sequence N description binding site for residue 63K A 1401 source : AC1 8) chain A residue 1208 type sequence R description binding site for residue 63K A 1401 source : AC1 9) chain A residue 1211 type sequence M description binding site for residue 63K A 1401 source : AC1 10) chain A residue 1221 type sequence A description binding site for residue 63K A 1401 source : AC1 11) chain A residue 1222 type sequence D description binding site for residue 63K A 1401 source : AC1 12) chain A residue 1226 type sequence A description binding site for residue 63K A 1401 source : AC1 13) chain A residue 1200-1212 type prosite sequence FVHRDLAARNCML description PROTEIN_KINASE_TYR Tyrosine protein kinases specific active-site signature. FVHrDLAARNCML source prosite : PS00109 14) chain A residue 1289 type MOD_RES sequence T description Phosphothreonine => ECO:0007744|PubMed:19369195 source Swiss-Prot : SWS_FT_FI7 15) chain A residue 1349 type MOD_RES sequence Y description Phosphotyrosine; by autocatalysis => ECO:0000269|PubMed:12475979, ECO:0000269|PubMed:7513258 source Swiss-Prot : SWS_FT_FI8 16) chain A residue 1356 type MOD_RES sequence Y description Phosphotyrosine; by autocatalysis => ECO:0000269|PubMed:15735664, ECO:0000269|PubMed:7513258 source Swiss-Prot : SWS_FT_FI9 17) chain A residue 1204 type ACT_SITE sequence D description Proton acceptor => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000255|PROSITE-ProRule:PRU10028 source Swiss-Prot : SWS_FT_FI1 18) chain A residue 1110 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI3

Display surface Download Links