eF-site ID 5gzo-D
PDB Code 5gzo
Chain D

click to enlarge
Title Structure of neutralizing antibody bound to Zika envelope protein
Classification VIRAL PROTEIN/IMMUNE SYSTEM
Compound Genome polyprotein
Source Zika virus (strain Mr 766) (ZIKV) (5GZO)
Sequence D:  DIVMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKP
GKAPKRLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQP
EDFATYYCLQHNSYPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG
LSSPVTKSFNRGE
Description (1)  Genome polyprotein, Antibody heavy chain, Antibody light chain

Display surface

Download
Links