eF-site ID 5gwo-C PDB Code 5gwo Chain C click to enlarge Title Crystal structure of RCAR3:PP2C S265F/I267M with (+)-ABA Classification HYDROLASE/RECEPTOR Compound Probable protein phosphatase 2C 50 Source Oryza sativa subsp. japonica (Rice) (K4N2F7_ORYSA) Sequence C:  TEYVRRFHRHEPRDHQCSSAVAKHIKAPVHLVWSLVRRFD QPQLFKPFVSRCEMKGNIEIGSVREVNVKSGLPATRSTER LELLDDNEHILSVRFVGGDHRLKNYSSILTVHPEVIDGRP GTLVIESFVVDVPEGNTKDETCYFVEALLKCNLKSLAEVS ERLVV Description Functional site 1) chain C residue 76 type sequence K description binding site for residue A8S C 301 source : AC6 2) chain C residue 102 type sequence L description binding site for residue A8S C 301 source : AC6 3) chain C residue 107 type sequence S description binding site for residue A8S C 301 source : AC6 4) chain C residue 125 type sequence F description binding site for residue A8S C 301 source : AC6 5) chain C residue 174 type sequence F description binding site for residue A8S C 301 source : AC6 6) chain C residue 178 type sequence L description binding site for residue A8S C 301 source : AC6 7) chain C residue 182 type sequence N description binding site for residue A8S C 301 source : AC6 8) chain C residue 76 type BINDING sequence K description BINDING => ECO:0000269|PubMed:28827170, ECO:0007744|PDB:5GWP source Swiss-Prot : SWS_FT_FI1 9) chain C residue 104 type BINDING sequence A description BINDING => ECO:0000250|UniProtKB:O49686 source Swiss-Prot : SWS_FT_FI2 10) chain C residue 131 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:O49686 source Swiss-Prot : SWS_FT_FI2 11) chain C residue 156 type BINDING sequence E description BINDING => ECO:0000250|UniProtKB:O49686 source Swiss-Prot : SWS_FT_FI2 12) chain C residue 77 type SITE sequence P description Involved in ABA binding => ECO:0000250|UniProtKB:Q84MC7 source Swiss-Prot : SWS_FT_FI3 13) chain C residue 175 type SITE sequence V description Involved in ABA binding => ECO:0000250|UniProtKB:Q84MC7 source Swiss-Prot : SWS_FT_FI3 14) chain C residue 103 type SITE sequence P description Involved in interactions with PP2Cs => ECO:0000250|UniProtKB:O49686 source Swiss-Prot : SWS_FT_FI4 15) chain C residue 167 type SITE sequence T description Involved in interactions with PP2Cs => ECO:0000250|UniProtKB:O49686 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links