eF-site ID 5gtj-D PDB Code 5gtj Chain D click to enlarge Title CRYSTAL STRUCTURE OF CATALYTICALLY ACTIVE FORM OF HUMAN DUSP26 Classification HYDROLASE Compound Dual specificity protein phosphatase 26 Source Homo sapiens (Human) (DUS26_HUMAN) Sequence D:  HPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANN RRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAH DSPAFDMSIHFQTAADFIHRALSQPGGKILVHSAVGVSRS ATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLL ALDRRLRQ Description (1)  Dual specificity protein phosphatase 26 (E.C.3.1.3.16,3.1.3.48) Functional site 1) chain D residue 120 type sequence D description binding site for residue PO4 D 301 source : AC4 2) chain D residue 152 type sequence S description binding site for residue PO4 D 301 source : AC4 3) chain D residue 153 type sequence A description binding site for residue PO4 D 301 source : AC4 4) chain D residue 154 type sequence V description binding site for residue PO4 D 301 source : AC4 5) chain D residue 155 type sequence G description binding site for residue PO4 D 301 source : AC4 6) chain D residue 156 type sequence V description binding site for residue PO4 D 301 source : AC4 7) chain D residue 157 type sequence S description binding site for residue PO4 D 301 source : AC4 8) chain D residue 158 type sequence R description binding site for residue PO4 D 301 source : AC4 9) chain D residue 152 type ACT_SITE sequence S description Phosphocysteine intermediate => ECO:0000255|PROSITE-ProRule:PRU00160 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links