eF-site ID 5g1e-B
PDB Code 5g1e
Chain B

click to enlarge
Title The complex structure of syntenin-1 PDZ domain with c-terminal extension
Classification SIGNALING PROTEIN
Compound SYNTENIN-1
Source Rattus norvegicus (Rat) (SDCB1_RAT)
Sequence B:  QGIREVILCKDQDGKIGLRLKSVDNGIFVQLVQANSPASL
VGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFITMTIRD
RPFERTVTMHKDSSGHVGFIFKSGKITSIVKDSSAARNGL
LTDHHICEINQNVIGLKDAQIADILSTTVVTITIMPAFIF
EHII
Description (1)  SYNTENIN-1


Functional site

1) chain B
residue 161-172
type prosite
ligand
sequence LQINGENCAGWS
description Aldehyde dehydrogenases cysteine active site.[FYLVA]-x-{GVEP}-{DILV}-G-[QE]-{LPYG}-C-[LIVMGSTANC]-[AGCN]-{HE}-[GSTADNEKR].
source prosite : PS00070


Display surface

Download
Links