eF-site ID 5fxy-C
PDB Code 5fxy
Chain C

click to enlarge
Title Structure of the human RBBP4:MTA1(464-546) complex
Classification TRANSCRIPTION
Compound HISTONE-BINDING PROTEIN RBBP4
Source Homo sapiens (Human) (MTA1_HUMAN)
Sequence C:  DAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQW
LPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPND
GEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIAT
KTPSSDVLVFDYTKHPSKPDPECNPDLRLRGGYGLSWNPN
LSGHLLSASDDHTICLWDISAVGKVVDAKTIFTGHTAVVE
DVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDA
HTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLH
SFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIG
EEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVIC
SVSEDNIMQVWQMAENIYND
Description (1)  HISTONE-BINDING PROTEIN RBBP4, METASTASIS-ASSOCIATED PROTEIN MTA1

Display surface

Download
Links