eF-site ID 5fxy-ABCDEFGH
PDB Code 5fxy
Chain A, B, C, D, E, F, G, H

click to enlarge
Title Structure of the human RBBP4:MTA1(464-546) complex
Classification TRANSCRIPTION
Compound HISTONE-BINDING PROTEIN RBBP4
Source Homo sapiens (Human) (MTA1_HUMAN)
Sequence A:  DAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQW
LPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPND
GEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIAT
KTPSSDVLVFDYTKHPSKPDPECNPDLRLRGGYGLSWNPN
LSGHLLSASDDHTICLWDISAVPGKVVDAKTIFTGHTAVV
EDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVD
AHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKL
HSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKI
GEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVI
CSVSEDNIMQVWQMAENIYND
B:  RQAFYLHTTKLTRIARRLCREILRPWHAARHPYLPINSAA
IKAECTARLPEAVRKPLEAVLRYLETHPR
C:  DAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQW
LPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPND
GEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIAT
KTPSSDVLVFDYTKHPSKPDPECNPDLRLRGGYGLSWNPN
LSGHLLSASDDHTICLWDISAVGKVVDAKTIFTGHTAVVE
DVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDA
HTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLH
SFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIG
EEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVIC
SVSEDNIMQVWQMAENIYND
D:  RQAFYLHTTKLTRIARRLCREILRPWHAARHPYLPINSAA
IKAECTARLPEAVRKPLEAVLRYLETHPR
E:  DAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQW
LPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPND
GEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIAT
KTPSSDVLVFDYTKHPSKPDPECNPDLRLRGGYGLSWNPN
LSGHLLSASDDHTICLWDISAVGKVVDAKTIFTGHTAVVE
DVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDA
HTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLH
SFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIG
EEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVIC
SVSEDNIMQVWQMAENIYND
F:  QAFYLHTTKLTRIARRLCREILRPWHAARHPYLPINSAAI
KAECTARLPEAVRKPLEAVLRYLETHPR
G:  DAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQW
LPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPND
GEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIAT
KTPSSDVLVFDYTKHPSKPDPECNPDLRLRGGYGLSWNPN
LSGHLLSASDDHTICLWDISAVPGKVVDAKTIFTGHTAVV
EDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVD
AHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKL
HSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKI
GEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVI
CSVSEDNIMQVWQMAENIYND
H:  RQAFYLHTTKLTRIARRLCREILRPWHAARHPYLPINSAA
IKAECTARLPEVRKPLEAVLRYLETHPR
Description (1)  HISTONE-BINDING PROTEIN RBBP4, METASTASIS-ASSOCIATED PROTEIN MTA1

Display surface

Download
Links