eF-site ID 5fxy-D PDB Code 5fxy Chain D click to enlarge Title Structure of the human RBBP4:MTA1(464-546) complex Classification TRANSCRIPTION Compound HISTONE-BINDING PROTEIN RBBP4 Source null (MTA1_HUMAN) Sequence D:  RQAFYLHTTKLTRIARRLCREILRPWHAARHPYLPINSAA IKAECTARLPEAVRKPLEAVLRYLETHPR Description Functional site 1) chain D residue 509 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2 and SUMO3) source Swiss-Prot : SWS_FT_FI2

Display surface Download Links