eF-site ID 5fvz-AB PDB Code 5fvz Chain A, B click to enlarge Title Structure of bovine endothelial nitric oxide synthase heme domain in complex with 6-(2-(5-(3-(dimethylamino)propyl)pyridin-3-yl)ethyl)-4-methylpyridin-2-amine Classification OXIDOREDUCTASE Compound ENDOTHELIAL NITRIC OXIDE SYNTHASE Source Bos taurus (Bovine) (NOS3_BOVIN) Sequence A:  GPKFPRVKNWELGSITYDTLCAQSQQDGPCTPRRCLGSLV LPRPAEQLLSQARDFINQYYSSIKRSGSQAHEERLQEVEA EVASTGTYHLRESELVFGAKQAWRNAPRCVGRIQWGKLQV FDARDCSSAQEMFTYICNHIKYATNRGNLRSAITVFPQRA PGRGDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCI QHGWTPGNGRFDVLPLLLQAPDEAPELFVLPPELVLEVPL EHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFSAAPFSG WYMSTEIGTRNLCDPHRYNILEDVAVXMDLDTRTTSSLWK DKAAVEINLAVLHSFQLAKVTIVDHHAATVSFMKHLDNEQ KARGGCPADWAWIVPPISGSLTPVFHQEMVNYILSPAFRY QPDPW B:  KFPRVKNWELGSITYDTLCAQSQQDGPCTPRRCLGSLVLP RKAEQLLSQARDFINQYYSSIKRSGSQAHEERLQEVEAEV ASTGTYHLRESELVFGAKQAWRNAPRCVGRIQWGKLQVFD ARDCSSAQEMFTYICNHIKYATNRGNLRSAITVFPQRAPG RGDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQH GWTPGNGRFDVLPLLLQAPDEAPELFVLPPELVLEVPLEH PTLEWFAALGLRWYALPAVSNMLLEIGGLEFSAAPFSGWY MSTEIGTRNLCDPHRYNILEDVAVXMDLDTRTTSSLWKDK AAVEINLAVLHSFQLAKVTIVDHHAATVSFMKHLDNEQKA RGGCPADWAWIVPPISGSLTPVFHQEMVNYILSPAFRYQP DPW Description (1)  ENDOTHELIAL NITRIC OXIDE SYNTHASE (E.C.1.14.13.39) Functional site 1) chain A residue 180 type sequence W description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 2) chain A residue 186 type sequence C description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 3) chain A residue 228 type sequence S description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 4) chain A residue 355 type sequence F description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 5) chain A residue 356 type sequence S description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 6) chain A residue 358 type sequence W description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 7) chain A residue 360 type sequence M description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 8) chain A residue 363 type sequence E description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 9) chain A residue 449 type sequence W description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 10) chain A residue 475 type sequence F description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 11) chain A residue 477 type sequence Y description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 12) chain A residue 104 type sequence S description BINDING SITE FOR RESIDUE H4B A 600 source : AC2 13) chain A residue 367 type sequence R description BINDING SITE FOR RESIDUE H4B A 600 source : AC2 14) chain A residue 448 type sequence A description BINDING SITE FOR RESIDUE H4B A 600 source : AC2 15) chain A residue 449 type sequence W description BINDING SITE FOR RESIDUE H4B A 600 source : AC2 16) chain B residue 447 type sequence W description BINDING SITE FOR RESIDUE H4B A 600 source : AC2 17) chain B residue 462 type sequence F description BINDING SITE FOR RESIDUE H4B A 600 source : AC2 18) chain B residue 463 type sequence H description BINDING SITE FOR RESIDUE H4B A 600 source : AC2 19) chain B residue 464 type sequence Q description BINDING SITE FOR RESIDUE H4B A 600 source : AC2 20) chain A residue 249 type sequence Q description BINDING SITE FOR RESIDUE W67 A 800 source : AC3 21) chain A residue 338 type sequence V description BINDING SITE FOR RESIDUE W67 A 800 source : AC3 22) chain A residue 355 type sequence F description BINDING SITE FOR RESIDUE W67 A 800 source : AC3 23) chain A residue 357 type sequence G description BINDING SITE FOR RESIDUE W67 A 800 source : AC3 24) chain A residue 358 type sequence W description BINDING SITE FOR RESIDUE W67 A 800 source : AC3 25) chain A residue 363 type sequence E description BINDING SITE FOR RESIDUE W67 A 800 source : AC3 26) chain A residue 477 type sequence Y description BINDING SITE FOR RESIDUE W67 A 800 source : AC3 27) chain A residue 367 type sequence R description BINDING SITE FOR RESIDUE GOL A 880 source : AC4 28) chain A residue 373 type sequence H description BINDING SITE FOR RESIDUE GOL A 880 source : AC4 29) chain A residue 249 type sequence Q description BINDING SITE FOR RESIDUE CL A 901 source : AC5 30) chain A residue 359 type sequence Y description BINDING SITE FOR RESIDUE CL A 901 source : AC5 31) chain A residue 368 type sequence N description BINDING SITE FOR RESIDUE CL A 901 source : AC5 32) chain B residue 180 type sequence W description BINDING SITE FOR RESIDUE HEM B 500 source : AC6 33) chain B residue 186 type sequence C description BINDING SITE FOR RESIDUE HEM B 500 source : AC6 34) chain B residue 228 type sequence S description BINDING SITE FOR RESIDUE HEM B 500 source : AC6 35) chain B residue 355 type sequence F description BINDING SITE FOR RESIDUE HEM B 500 source : AC6 36) chain B residue 356 type sequence S description BINDING SITE FOR RESIDUE HEM B 500 source : AC6 37) chain B residue 358 type sequence W description BINDING SITE FOR RESIDUE HEM B 500 source : AC6 38) chain B residue 363 type sequence E description BINDING SITE FOR RESIDUE HEM B 500 source : AC6 39) chain B residue 449 type sequence W description BINDING SITE FOR RESIDUE HEM B 500 source : AC6 40) chain B residue 477 type sequence Y description BINDING SITE FOR RESIDUE HEM B 500 source : AC6 41) chain A residue 447 type sequence W description BINDING SITE FOR RESIDUE H4B B 600 source : AC7 42) chain A residue 462 type sequence F description BINDING SITE FOR RESIDUE H4B B 600 source : AC7 43) chain A residue 463 type sequence H description BINDING SITE FOR RESIDUE H4B B 600 source : AC7 44) chain A residue 464 type sequence Q description BINDING SITE FOR RESIDUE H4B B 600 source : AC7 45) chain B residue 104 type sequence S description BINDING SITE FOR RESIDUE H4B B 600 source : AC7 46) chain B residue 367 type sequence R description BINDING SITE FOR RESIDUE H4B B 600 source : AC7 47) chain B residue 448 type sequence A description BINDING SITE FOR RESIDUE H4B B 600 source : AC7 48) chain B residue 449 type sequence W description BINDING SITE FOR RESIDUE H4B B 600 source : AC7 49) chain B residue 249 type sequence Q description BINDING SITE FOR RESIDUE W67 B 800 source : AC8 50) chain B residue 357 type sequence G description BINDING SITE FOR RESIDUE W67 B 800 source : AC8 51) chain B residue 358 type sequence W description BINDING SITE FOR RESIDUE W67 B 800 source : AC8 52) chain B residue 359 type sequence Y description BINDING SITE FOR RESIDUE W67 B 800 source : AC8 53) chain B residue 363 type sequence E description BINDING SITE FOR RESIDUE W67 B 800 source : AC8 54) chain B residue 449 type sequence W description BINDING SITE FOR RESIDUE W67 B 800 source : AC8 55) chain B residue 477 type sequence Y description BINDING SITE FOR RESIDUE W67 B 800 source : AC8 56) chain A residue 76 type sequence W description BINDING SITE FOR RESIDUE GOL B 880 source : AC9 57) chain B residue 106 type sequence V description BINDING SITE FOR RESIDUE GOL B 880 source : AC9 58) chain B residue 367 type sequence R description BINDING SITE FOR RESIDUE GOL B 880 source : AC9 59) chain B residue 373 type sequence H description BINDING SITE FOR RESIDUE GOL B 880 source : AC9 60) chain B residue 449 type sequence W description BINDING SITE FOR RESIDUE GOL B 880 source : AC9 61) chain B residue 249 type sequence Q description BINDING SITE FOR RESIDUE CL B 901 source : BC1 62) chain B residue 359 type sequence Y description BINDING SITE FOR RESIDUE CL B 901 source : BC1 63) chain B residue 368 type sequence N description BINDING SITE FOR RESIDUE CL B 901 source : BC1 64) chain A residue 96 type sequence C description BINDING SITE FOR RESIDUE ZN A 900 source : BC2 65) chain A residue 101 type sequence C description BINDING SITE FOR RESIDUE ZN A 900 source : BC2 66) chain B residue 96 type sequence C description BINDING SITE FOR RESIDUE ZN A 900 source : BC2 67) chain B residue 101 type sequence C description BINDING SITE FOR RESIDUE ZN A 900 source : BC2 68) chain A residue 185-192 type prosite sequence RCVGRIQW description NOS Nitric oxide synthase (NOS) signature. RCVGRIqW source prosite : PS60001 69) chain A residue 104 type BINDING sequence S description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 70) chain A residue 477 type BINDING sequence Y description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 71) chain B residue 104 type BINDING sequence S description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 72) chain B residue 249 type BINDING sequence Q description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 73) chain B residue 358 type BINDING sequence W description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 74) chain B residue 359 type BINDING sequence Y description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 75) chain B residue 363 type BINDING sequence E description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 76) chain B residue 368 type BINDING sequence N description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 77) chain B residue 448 type BINDING sequence A description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 78) chain B residue 449 type BINDING sequence W description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 79) chain B residue 462 type BINDING sequence F description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 80) chain A residue 249 type BINDING sequence Q description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 81) chain B residue 477 type BINDING sequence Y description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 82) chain A residue 358 type BINDING sequence W description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 83) chain A residue 359 type BINDING sequence Y description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 84) chain A residue 363 type BINDING sequence E description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 85) chain A residue 368 type BINDING sequence N description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 86) chain A residue 448 type BINDING sequence A description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 87) chain A residue 449 type BINDING sequence W description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 88) chain A residue 462 type BINDING sequence F description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 89) chain A residue 186 type BINDING sequence C description axial binding residue => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI3 90) chain B residue 186 type BINDING sequence C description axial binding residue => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI3 91) chain A residue 96 type BINDING sequence C description BINDING => ECO:0000250|UniProtKB:P35228 source Swiss-Prot : SWS_FT_FI1 92) chain A residue 101 type BINDING sequence C description BINDING => ECO:0000250|UniProtKB:P35228 source Swiss-Prot : SWS_FT_FI1 93) chain B residue 96 type BINDING sequence C description BINDING => ECO:0000250|UniProtKB:P35228 source Swiss-Prot : SWS_FT_FI1 94) chain B residue 101 type BINDING sequence C description BINDING => ECO:0000250|UniProtKB:P35228 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links