eF-site ID 5fvz-A PDB Code 5fvz Chain A click to enlarge Title Structure of bovine endothelial nitric oxide synthase heme domain in complex with 6-(2-(5-(3-(dimethylamino)propyl)pyridin-3-yl)ethyl)-4-methylpyridin-2-amine Classification OXIDOREDUCTASE Compound ENDOTHELIAL NITRIC OXIDE SYNTHASE Source Bos taurus (Bovine) (NOS3_BOVIN) Sequence A:  GPKFPRVKNWELGSITYDTLCAQSQQDGPCTPRRCLGSLV LPRPAEQLLSQARDFINQYYSSIKRSGSQAHEERLQEVEA EVASTGTYHLRESELVFGAKQAWRNAPRCVGRIQWGKLQV FDARDCSSAQEMFTYICNHIKYATNRGNLRSAITVFPQRA PGRGDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCI QHGWTPGNGRFDVLPLLLQAPDEAPELFVLPPELVLEVPL EHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFSAAPFSG WYMSTEIGTRNLCDPHRYNILEDVAVXMDLDTRTTSSLWK DKAAVEINLAVLHSFQLAKVTIVDHHAATVSFMKHLDNEQ KARGGCPADWAWIVPPISGSLTPVFHQEMVNYILSPAFRY QPDPW Description (1)  ENDOTHELIAL NITRIC OXIDE SYNTHASE (E.C.1.14.13.39) Functional site 1) chain A residue 180 type sequence W description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 2) chain A residue 186 type sequence C description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 3) chain A residue 228 type sequence S description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 4) chain A residue 355 type sequence F description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 5) chain A residue 356 type sequence S description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 6) chain A residue 358 type sequence W description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 7) chain A residue 360 type sequence M description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 8) chain A residue 363 type sequence E description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 9) chain A residue 449 type sequence W description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 10) chain A residue 475 type sequence F description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 11) chain A residue 477 type sequence Y description BINDING SITE FOR RESIDUE HEM A 500 source : AC1 12) chain A residue 104 type sequence S description BINDING SITE FOR RESIDUE H4B A 600 source : AC2 13) chain A residue 367 type sequence R description BINDING SITE FOR RESIDUE H4B A 600 source : AC2 14) chain A residue 448 type sequence A description BINDING SITE FOR RESIDUE H4B A 600 source : AC2 15) chain A residue 449 type sequence W description BINDING SITE FOR RESIDUE H4B A 600 source : AC2 16) chain A residue 249 type sequence Q description BINDING SITE FOR RESIDUE W67 A 800 source : AC3 17) chain A residue 338 type sequence V description BINDING SITE FOR RESIDUE W67 A 800 source : AC3 18) chain A residue 355 type sequence F description BINDING SITE FOR RESIDUE W67 A 800 source : AC3 19) chain A residue 357 type sequence G description BINDING SITE FOR RESIDUE W67 A 800 source : AC3 20) chain A residue 358 type sequence W description BINDING SITE FOR RESIDUE W67 A 800 source : AC3 21) chain A residue 363 type sequence E description BINDING SITE FOR RESIDUE W67 A 800 source : AC3 22) chain A residue 477 type sequence Y description BINDING SITE FOR RESIDUE W67 A 800 source : AC3 23) chain A residue 367 type sequence R description BINDING SITE FOR RESIDUE GOL A 880 source : AC4 24) chain A residue 373 type sequence H description BINDING SITE FOR RESIDUE GOL A 880 source : AC4 25) chain A residue 249 type sequence Q description BINDING SITE FOR RESIDUE CL A 901 source : AC5 26) chain A residue 359 type sequence Y description BINDING SITE FOR RESIDUE CL A 901 source : AC5 27) chain A residue 368 type sequence N description BINDING SITE FOR RESIDUE CL A 901 source : AC5 28) chain A residue 447 type sequence W description BINDING SITE FOR RESIDUE H4B B 600 source : AC7 29) chain A residue 462 type sequence F description BINDING SITE FOR RESIDUE H4B B 600 source : AC7 30) chain A residue 463 type sequence H description BINDING SITE FOR RESIDUE H4B B 600 source : AC7 31) chain A residue 464 type sequence Q description BINDING SITE FOR RESIDUE H4B B 600 source : AC7 32) chain A residue 76 type sequence W description BINDING SITE FOR RESIDUE GOL B 880 source : AC9 33) chain A residue 96 type sequence C description BINDING SITE FOR RESIDUE ZN A 900 source : BC2 34) chain A residue 101 type sequence C description BINDING SITE FOR RESIDUE ZN A 900 source : BC2 35) chain A residue 185-192 type prosite sequence RCVGRIQW description NOS Nitric oxide synthase (NOS) signature. RCVGRIqW source prosite : PS60001 36) chain A residue 104 type BINDING sequence S description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 37) chain A residue 477 type BINDING sequence Y description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 38) chain A residue 249 type BINDING sequence Q description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 39) chain A residue 358 type BINDING sequence W description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 40) chain A residue 359 type BINDING sequence Y description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 41) chain A residue 363 type BINDING sequence E description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 42) chain A residue 368 type BINDING sequence N description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 43) chain A residue 448 type BINDING sequence A description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 44) chain A residue 449 type BINDING sequence W description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 45) chain A residue 462 type BINDING sequence F description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 46) chain A residue 186 type BINDING sequence C description axial binding residue => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI3 47) chain A residue 96 type BINDING sequence C description BINDING => ECO:0000250|UniProtKB:P35228 source Swiss-Prot : SWS_FT_FI1 48) chain A residue 101 type BINDING sequence C description BINDING => ECO:0000250|UniProtKB:P35228 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links