eF-site ID 5fvw-A PDB Code 5fvw Chain A click to enlarge Title Structure of human nNOS R354A G357D mutant heme domain in complex with 4-methyl-6-(2-(5-(3-(methylamino)propyl)pyridin-3-yl)ethyl) pyridin-2-amine Classification OXIDOREDUCTASE Compound NITRIC OXIDE SYNTHASE, BRAIN Source Homo sapiens (Human) (NOS1_HUMAN) Sequence A:  CPRFLKVKNWETEVVLTDTLHLKSTLETGCTEYICMGSIM HPDVATKDQLFPLAKEFIDQYYSSIKRFGSKAHMERLEEV NKEIDTTSTYQLKDTELIYGAKHAWRNASRCVGRIQWSKL QVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQ RTDGKHDFRVWNSQLIRYAGYKQPDGSTLGDPANVQFTEI CIQQGWKPPRGRFDVLPLLLQANGNDPELFQIPPELVLEV PIRHPKFEWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPF SGWYMGTEIGVRDYCDNSRYNILEEVAKKMNLDMRKTSSL WKDQALVEINIAVLYSFQSDKVTIVDHHSATESFIKHMEN EYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSF EYQPDPWNTHVWK Description (1)  NITRIC OXIDE SYNTHASE, BRAIN Functional site 1) chain A residue 414 type sequence W description BINDING SITE FOR RESIDUE HEM A 750 source : AC1 2) chain A residue 420 type sequence C description BINDING SITE FOR RESIDUE HEM A 750 source : AC1 3) chain A residue 589 type sequence F description BINDING SITE FOR RESIDUE HEM A 750 source : AC1 4) chain A residue 590 type sequence S description BINDING SITE FOR RESIDUE HEM A 750 source : AC1 5) chain A residue 591 type sequence G description BINDING SITE FOR RESIDUE HEM A 750 source : AC1 6) chain A residue 592 type sequence W description BINDING SITE FOR RESIDUE HEM A 750 source : AC1 7) chain A residue 594 type sequence M description BINDING SITE FOR RESIDUE HEM A 750 source : AC1 8) chain A residue 597 type sequence E description BINDING SITE FOR RESIDUE HEM A 750 source : AC1 9) chain A residue 683 type sequence W description BINDING SITE FOR RESIDUE HEM A 750 source : AC1 10) chain A residue 709 type sequence F description BINDING SITE FOR RESIDUE HEM A 750 source : AC1 11) chain A residue 711 type sequence Y description BINDING SITE FOR RESIDUE HEM A 750 source : AC1 12) chain A residue 339 type sequence S description BINDING SITE FOR RESIDUE H4B A 760 source : AC2 13) chain A residue 341 type sequence M description BINDING SITE FOR RESIDUE H4B A 760 source : AC2 14) chain A residue 601 type sequence R description BINDING SITE FOR RESIDUE H4B A 760 source : AC2 15) chain A residue 682 type sequence V description BINDING SITE FOR RESIDUE H4B A 760 source : AC2 16) chain A residue 683 type sequence W description BINDING SITE FOR RESIDUE H4B A 760 source : AC2 17) chain A residue 486 type sequence R description BINDING SITE FOR RESIDUE W66 A 800 source : AC3 18) chain A residue 567 type sequence Y description BINDING SITE FOR RESIDUE W66 A 800 source : AC3 19) chain A residue 572 type sequence V description BINDING SITE FOR RESIDUE W66 A 800 source : AC3 20) chain A residue 592 type sequence W description BINDING SITE FOR RESIDUE W66 A 800 source : AC3 21) chain A residue 593 type sequence Y description BINDING SITE FOR RESIDUE W66 A 800 source : AC3 22) chain A residue 597 type sequence E description BINDING SITE FOR RESIDUE W66 A 800 source : AC3 23) chain A residue 331 type sequence C description BINDING SITE FOR RESIDUE ZN A 900 source : AC4 24) chain A residue 336 type sequence C description BINDING SITE FOR RESIDUE ZN A 900 source : AC4 25) chain A residue 681 type sequence W description BINDING SITE FOR RESIDUE H4B B 760 source : AC6 26) chain A residue 696 type sequence F description BINDING SITE FOR RESIDUE H4B B 760 source : AC6 27) chain A residue 697 type sequence H description BINDING SITE FOR RESIDUE H4B B 760 source : AC6 28) chain A residue 698 type sequence Q description BINDING SITE FOR RESIDUE H4B B 760 source : AC6 29) chain A residue 420 type BINDING sequence C description axial binding residue => ECO:0000269|PubMed:25286850, ECO:0007744|PDB:4D1N source Swiss-Prot : SWS_FT_FI2 30) chain A residue 419-426 type prosite sequence RCVGRIQW description NOS Nitric oxide synthase (NOS) signature. RCVGRIqW source prosite : PS60001 31) chain A residue 339 type BINDING sequence S description BINDING => ECO:0000269|PubMed:25286850, ECO:0007744|PDB:4D1N source Swiss-Prot : SWS_FT_FI1 32) chain A residue 483 type BINDING sequence Q description BINDING => ECO:0000269|PubMed:25286850, ECO:0007744|PDB:4D1N source Swiss-Prot : SWS_FT_FI1 33) chain A residue 592 type BINDING sequence W description BINDING => ECO:0000269|PubMed:25286850, ECO:0007744|PDB:4D1N source Swiss-Prot : SWS_FT_FI1 34) chain A residue 593 type BINDING sequence Y description BINDING => ECO:0000269|PubMed:25286850, ECO:0007744|PDB:4D1N source Swiss-Prot : SWS_FT_FI1 35) chain A residue 597 type BINDING sequence E description BINDING => ECO:0000269|PubMed:25286850, ECO:0007744|PDB:4D1N source Swiss-Prot : SWS_FT_FI1 36) chain A residue 682 type BINDING sequence V description BINDING => ECO:0000269|PubMed:25286850, ECO:0007744|PDB:4D1N source Swiss-Prot : SWS_FT_FI1 37) chain A residue 683 type BINDING sequence W description BINDING => ECO:0000269|PubMed:25286850, ECO:0007744|PDB:4D1N source Swiss-Prot : SWS_FT_FI1 38) chain A residue 696 type BINDING sequence F description BINDING => ECO:0000269|PubMed:25286850, ECO:0007744|PDB:4D1N source Swiss-Prot : SWS_FT_FI1 39) chain A residue 711 type BINDING sequence Y description BINDING => ECO:0000269|PubMed:25286850, ECO:0007744|PDB:4D1N source Swiss-Prot : SWS_FT_FI1

Display surface Download Links