eF-site ID 5fr1-AB PDB Code 5fr1 Chain A, B click to enlarge Title Double acetylated RhoGDI-alpha in complex with RhoA-GDP Classification SIGNALING PROTEIN Compound TRANSFORMING PROTEIN RHOA Source (GDIR1_BOVIN) Sequence A:  IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYV ADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMC FSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRN DEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKT KDGVREVFEMATRAALQASGCLVL B:  NYKPPAQKSIQEIQELDKDDESLRKYKEALLVPNVVVTRL TLVCSTAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKIS FRVNREIVSGMXYIQHTYRKGVKIDXTDYMVGSYGPRAEE YEFLTPMEEAPKGMLARGSYNIKSRFTDDDRTDHLSWEWN LTIKKEW Description Functional site 1) chain A residue 13 type sequence D description BINDING SITE FOR RESIDUE GDP A 1194 source : AC1 2) chain A residue 15 type sequence A description BINDING SITE FOR RESIDUE GDP A 1194 source : AC1 3) chain A residue 16 type sequence C description BINDING SITE FOR RESIDUE GDP A 1194 source : AC1 4) chain A residue 17 type sequence G description BINDING SITE FOR RESIDUE GDP A 1194 source : AC1 5) chain A residue 18 type sequence K description BINDING SITE FOR RESIDUE GDP A 1194 source : AC1 6) chain A residue 19 type sequence T description BINDING SITE FOR RESIDUE GDP A 1194 source : AC1 7) chain A residue 20 type sequence C description BINDING SITE FOR RESIDUE GDP A 1194 source : AC1 8) chain A residue 30 type sequence F description BINDING SITE FOR RESIDUE GDP A 1194 source : AC1 9) chain A residue 35 type sequence V description BINDING SITE FOR RESIDUE GDP A 1194 source : AC1 10) chain A residue 118 type sequence K description BINDING SITE FOR RESIDUE GDP A 1194 source : AC1 11) chain A residue 120 type sequence D description BINDING SITE FOR RESIDUE GDP A 1194 source : AC1 12) chain A residue 121 type sequence L description BINDING SITE FOR RESIDUE GDP A 1194 source : AC1 13) chain A residue 160 type sequence S description BINDING SITE FOR RESIDUE GDP A 1194 source : AC1 14) chain A residue 161 type sequence A description BINDING SITE FOR RESIDUE GDP A 1194 source : AC1 15) chain A residue 162 type sequence K description BINDING SITE FOR RESIDUE GDP A 1194 source : AC1 16) chain A residue 19 type sequence T description BINDING SITE FOR RESIDUE MG A 1195 source : AC2 17) chain A residue 37 type sequence T description BINDING SITE FOR RESIDUE MG A 1195 source : AC2 18) chain A residue 43 type sequence V description BINDING SITE FOR RESIDUE MG A 1196 source : AC3 19) chain A residue 45 type sequence D description BINDING SITE FOR RESIDUE MG A 1196 source : AC3 20) chain B residue 117 type sequence R description BINDING SITE FOR RESIDUE MG B 1203 source : AC4 21) chain B residue 118 type sequence V description BINDING SITE FOR RESIDUE MG B 1203 source : AC4 22) chain B residue 152 type sequence R description BINDING SITE FOR RESIDUE MG B 1203 source : AC4 23) chain B residue 154 type sequence E description BINDING SITE FOR RESIDUE MG B 1203 source : AC4 24) chain B residue 105 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P52565 source Swiss-Prot : SWS_FT_FI6 25) chain B residue 127 type MOD_RES sequence X description N6-acetyllysine => ECO:0000250|UniProtKB:P52565 source Swiss-Prot : SWS_FT_FI6 26) chain B residue 178 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P52565 source Swiss-Prot : SWS_FT_FI6 27) chain A residue 34 type CARBOHYD sequence Y description (Microbial infection) O-linked (GlcNAc) tyrosine; by Photorhabdus PAU_02230; alternate => ECO:0000269|PubMed:24141704 source Swiss-Prot : SWS_FT_FI12 28) chain A residue 135 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:23871831 source Swiss-Prot : SWS_FT_FI14 29) chain A residue 117 type MOD_RES sequence N description N-acetylalanine => ECO:0000250|UniProtKB:P52565 source Swiss-Prot : SWS_FT_FI1 30) chain B residue 34 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:Q99PT1 source Swiss-Prot : SWS_FT_FI2 31) chain A residue 59 type MOD_RES sequence D description Phosphoserine => ECO:0000250|UniProtKB:Q99PT1 source Swiss-Prot : SWS_FT_FI2 32) chain A residue 160 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:Q99PT1 source Swiss-Prot : SWS_FT_FI2 33) chain B residue 43 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:Q99PT1 source Swiss-Prot : SWS_FT_FI3 34) chain B residue 47 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P52565 source Swiss-Prot : SWS_FT_FI4 35) chain B residue 101 type MOD_RES sequence S description Phosphoserine; by PKA => ECO:0000255 source Swiss-Prot : SWS_FT_FI5 36) chain A residue 190 type LIPID sequence C description S-geranylgeranyl cysteine => ECO:0000250|UniProtKB:P61585 source Swiss-Prot : SWS_FT_FI11 37) chain B residue 115 type MOD_RES sequence S description Phosphoserine; by PKC => ECO:0000255 source Swiss-Prot : SWS_FT_FI7 38) chain B residue 141 type MOD_RES sequence X description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:Q99PT1 source Swiss-Prot : SWS_FT_FI8 39) chain B residue 138 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0000250|UniProtKB:P52565 source Swiss-Prot : SWS_FT_FI9 40) chain B residue 141 type CROSSLNK sequence X description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0000250|UniProtKB:P52565 source Swiss-Prot : SWS_FT_FI9 41) chain A residue 37 type CARBOHYD sequence T description (Microbial infection) O-linked (Glc) threonine; by C.difficile toxins TcdA and TcdB; alternate => ECO:0000269|PubMed:24905543, ECO:0000269|PubMed:7775453, ECO:0000269|PubMed:7777059 source Swiss-Prot : SWS_FT_FI13

Display surface Download Links