eF-site ID 5ffv-ABCD PDB Code 5ffv Chain A, B, C, D click to enlarge Title Crystal structure of the bromodomain of human BRPF1 in complex with H3K14ac histone peptide Classification TRANSCRIPTION Compound Peregrin Source Homo sapiens (Human) (K7EMV3_HUMAN) Sequence A:  QLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDH IKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYN AKDTIFYRAAVRLREQGGAVLRQARRQAEKM B:  LTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHI KKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNA KDTIFYRAAVRLREQGGAVLRQARRQAE C:  STGGXAPR D:  STGGXAPR Description Functional site 1) chain A residue 663 type sequence P description binding site for residue EDO A 801 source : AC1 2) chain A residue 691 type sequence D description binding site for residue EDO A 801 source : AC1 3) chain A residue 733 type sequence R description binding site for residue EDO A 801 source : AC1 4) chain A residue 737 type sequence E description binding site for residue EDO A 801 source : AC1 5) chain B residue 730 type sequence R description binding site for residue EDO A 801 source : AC1 6) chain B residue 734 type sequence R description binding site for residue EDO A 801 source : AC1 7) chain A residue 712 type sequence T description binding site for residue EDO A 802 source : AC2 8) chain A residue 713 type sequence I description binding site for residue EDO A 802 source : AC2 9) chain B residue 677 type sequence T description binding site for residue EDO B 801 source : AC3 10) chain B residue 681 type sequence N description binding site for residue EDO B 801 source : AC3 11) chain C residue 11 type MOD_RES sequence T description Phosphothreonine; by PKC and CHEK1 => ECO:0000269|PubMed:12560483, ECO:0000269|PubMed:18066052, ECO:0000269|PubMed:18243098, ECO:0000269|PubMed:22901803 source Swiss-Prot : SWS_FT_FI3 12) chain D residue 11 type MOD_RES sequence T description Phosphothreonine; by PKC and CHEK1 => ECO:0000269|PubMed:12560483, ECO:0000269|PubMed:18066052, ECO:0000269|PubMed:18243098, ECO:0000269|PubMed:22901803 source Swiss-Prot : SWS_FT_FI3 13) chain C residue 10 type MOD_RES sequence S description Phosphoserine; alternate; by AURKB, AURKC, RPS6KA3, RPS6KA4 and RPS6KA5 => ECO:0000269|PubMed:10464286, ECO:0000269|PubMed:11856369, ECO:0000269|PubMed:12560483, ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:16457588 source Swiss-Prot : SWS_FT_FI2 14) chain D residue 10 type MOD_RES sequence S description Phosphoserine; alternate; by AURKB, AURKC, RPS6KA3, RPS6KA4 and RPS6KA5 => ECO:0000269|PubMed:10464286, ECO:0000269|PubMed:11856369, ECO:0000269|PubMed:12560483, ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:16457588 source Swiss-Prot : SWS_FT_FI2 15) chain C residue 14 type MOD_RES sequence X description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435 source Swiss-Prot : SWS_FT_FI4 16) chain D residue 14 type MOD_RES sequence X description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435 source Swiss-Prot : SWS_FT_FI4 17) chain C residue 17 type MOD_RES sequence R description Citrulline; alternate => ECO:0000269|PubMed:15345777, ECO:0000269|PubMed:16497732, ECO:0000269|PubMed:16567635 source Swiss-Prot : SWS_FT_FI5 18) chain D residue 17 type MOD_RES sequence R description Citrulline; alternate => ECO:0000269|PubMed:15345777, ECO:0000269|PubMed:16497732, ECO:0000269|PubMed:16567635 source Swiss-Prot : SWS_FT_FI5 19) chain A residue 650-707 type prosite sequence GNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLN FDDFEEDFNLIVSNCLKY description BROMODOMAIN_1 Bromodomain signature. GniFsepvPlsevp..DYLdhIkkpMdfftMkqnleayr..Ylnfddfeedfnl.IvsNClkY source prosite : PS00633

Display surface Download Links