eF-site ID 5ffv-A PDB Code 5ffv Chain A click to enlarge Title Crystal structure of the bromodomain of human BRPF1 in complex with H3K14ac histone peptide Classification TRANSCRIPTION Compound Peregrin Source Homo sapiens (Human) (K7EMV3_HUMAN) Sequence A:  QLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDH IKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYN AKDTIFYRAAVRLREQGGAVLRQARRQAEKM Description Functional site 1) chain A residue 663 type sequence P description binding site for residue EDO A 801 source : AC1 2) chain A residue 691 type sequence D description binding site for residue EDO A 801 source : AC1 3) chain A residue 733 type sequence R description binding site for residue EDO A 801 source : AC1 4) chain A residue 737 type sequence E description binding site for residue EDO A 801 source : AC1 5) chain A residue 712 type sequence T description binding site for residue EDO A 802 source : AC2 6) chain A residue 713 type sequence I description binding site for residue EDO A 802 source : AC2 7) chain A residue 650-707 type prosite sequence GNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLN FDDFEEDFNLIVSNCLKY description BROMODOMAIN_1 Bromodomain signature. GniFsepvPlsevp..DYLdhIkkpMdfftMkqnleayr..Ylnfddfeedfnl.IvsNClkY source prosite : PS00633

Display surface Download Links