eF-site ID 5fcd-B
PDB Code 5fcd
Chain B

click to enlarge
Title Crystal structure of MccD protein
Classification TRANSFERASE
Compound UNK-UNK-UNK-MSE-UNK
Source Escherichia coli (Q83Y56_ECOLX)
Sequence B:  NTPPGAEYTIDYWIKHGCINKKSHLLDLACSTGFSSRECF
KKEGASAEGIDISESAVXVANEKAKKLKANNLLKYYVADA
CDLPFEDNTFTHVLGGCNFAFIQNRLIALNETHRCLNHXG
SXCISNFYYRRKISDKLINDVYNAINFRPNPLWTLEYWHQ
FFSERFTLVSEENHEXESQSEDELKADIYDYIFNRNQNVF
FERFLKIRRPLNIQRDYQGVTLQIWRKK
Description (1)  UNK-UNK-UNK-MSE-UNK, UNK-UNK-UNK-UNK-MSE-UNK, MccD


Functional site

1) chain B
residue 133
type
ligand
sequence N
description binding site for residue CL A 301
source : AC1

2) chain B
residue 135
type
ligand
sequence L
description binding site for residue CL A 301
source : AC1


Display surface

Download
Links