eF-site ID 5fcd-ABDE
PDB Code 5fcd
Chain A, B, D, E

click to enlarge
Title Crystal structure of MccD protein
Classification TRANSFERASE
Compound UNK-UNK-UNK-MSE-UNK
Source Escherichia coli (Q83Y56_ECOLX)
Sequence A:  DNTPPGAEYTIDYWIKHGCINKKSHLLDLACSTGFSSREC
FKKEGASAEGIDISESAVXVANEKAKKLKANNLLKYYVAD
ACDLPFEDNTFTHVLGGCNFAFIQNRLIALNETHRCLNHX
GSXCISNFYYRRKISDKLINDVYNAINFRPNPLWTLEYWH
QFFSERFTLVSEENHEXESQSEDELKADIYDYIFNRQNVF
FERFLKIRRPLNIQRDYQGVTLQIWRKK
B:  NTPPGAEYTIDYWIKHGCINKKSHLLDLACSTGFSSRECF
KKEGASAEGIDISESAVXVANEKAKKLKANNLLKYYVADA
CDLPFEDNTFTHVLGGCNFAFIQNRLIALNETHRCLNHXG
SXCISNFYYRRKISDKLINDVYNAINFRPNPLWTLEYWHQ
FFSERFTLVSEENHEXESQSEDELKADIYDYIFNRNQNVF
FERFLKIRRPLNIQRDYQGVTLQIWRKK
D:  XXXXX
E:  XXXXXX
Description (1)  UNK-UNK-UNK-MSE-UNK, UNK-UNK-UNK-UNK-MSE-UNK, MccD


Functional site

1) chain A
residue 133
type
ligand
sequence N
description binding site for residue CL A 301
source : AC1

2) chain A
residue 134
type
ligand
sequence R
description binding site for residue CL A 301
source : AC1

3) chain A
residue 135
type
ligand
sequence L
description binding site for residue CL A 301
source : AC1

4) chain A
residue 136
type
ligand
sequence I
description binding site for residue CL A 301
source : AC1

5) chain B
residue 133
type
ligand
sequence N
description binding site for residue CL A 301
source : AC1

6) chain B
residue 135
type
ligand
sequence L
description binding site for residue CL A 301
source : AC1


Display surface

Download
Links