eF-site ID 5f7b-B PDB Code 5f7b Chain B click to enlarge Title Resting state structure of CuNiR form Alcaligenes faecalis determined at 293 K Classification OXIDOREDUCTASE Compound Copper-containing nitrite reductase Source (NIR_ALCFA) Sequence B:  ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTM VIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLEL TLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILR FKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLH DGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAY EDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLI VHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFI PGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVT GEWNDDLMTSVLAPSGT Description Functional site 1) chain B residue 95 type sequence H description binding site for residue CU B 501 source : AC3 2) chain B residue 136 type sequence C description binding site for residue CU B 501 source : AC3 3) chain B residue 145 type sequence H description binding site for residue CU B 501 source : AC3 4) chain B residue 150 type sequence M description binding site for residue CU B 501 source : AC3 5) chain B residue 100 type sequence H description binding site for residue CU B 502 source : AC4 6) chain B residue 135 type sequence H description binding site for residue CU B 502 source : AC4 7) chain B residue 306 type sequence H description binding site for residue CU C 502 source : AC6 8) chain B residue 95 type BINDING sequence H description type 1 copper site => ECO:0000269|PubMed:8172899 source Swiss-Prot : SWS_FT_FI1 9) chain B residue 100 type BINDING sequence H description type 2 copper site source Swiss-Prot : SWS_FT_FI2 10) chain B residue 135 type BINDING sequence H description type 2 copper site source Swiss-Prot : SWS_FT_FI2 11) chain B residue 136 type BINDING sequence C description type 1 copper site source Swiss-Prot : SWS_FT_FI3 12) chain B residue 145 type BINDING sequence H description type 1 copper site source Swiss-Prot : SWS_FT_FI3 13) chain B residue 150 type BINDING sequence M description type 1 copper site source Swiss-Prot : SWS_FT_FI3 14) chain B residue 306 type BINDING sequence H description type 2 copper site => ECO:0000269|PubMed:8172899 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links